DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sufu and Su(fu)

Sequence 1:NP_056567.2 Gene:Sufu MGIID:1345643 Length:485 Species:Mus musculus
Sequence 2:NP_536750.2 Gene:Su(fu) FlyBaseID:FBgn0005355 Length:468 Species:Drosophila melanogaster

Alignment Length:514 Identity:189/515 (37%)
Similarity:264/515 (51%) Gaps:92/515 (18%)


Mouse     1 MAEL----RPSVAPGPAAPPASGPSAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKYW 61
            |||.    :|.|.|                    ||||.||.....::||:||||||||.::|||
  Fly     1 MAEANLDKKPEVKP--------------------PPGLKAIIDHLGQVYPNQPNPLQVTTLLKYW 45

Mouse    62 LGGPDPLDYVSMYRNMGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFELTFRLKR 126
            |||.|||||:|||...|....|:|.||||||||||||:||.|||........||.||||||||.:
  Fly    46 LGGQDPLDYISMYNYPGDVDRNVPPHWHYISFGLSDLHGDERVHLREEGVTRSGMGFELTFRLAK 110

Mouse   127 ETGE-----------SAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNS-ESRIQHMLL 179
            ...|           ..||||||.|:|.:.||.||:.|..|.||::.|...||.| .|::|::|:
  Fly   111 TEIELKQQIENPEKPQRPPTWPANLLQAIGRYCFQTGNGLCFGDNIPWRKSLDGSTTSKLQNLLV 175

Mouse   180 TEDPQMQPVRTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPIAGGPWLITDMRRGETI 244
            .:|||:..:.||.|.|.|.|||||..:||..|.:|||:|:|..||.....||.||:|:|.|..::
  Fly   176 AQDPQLGCIDTPTGTVDFCQIVGVFDDELEQASRWNGRGVLNFLRQDMQTGGDWLVTNMDRQMSV 240

Mouse   245 FEIDP----HLQQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDEED------SRSICLGTQPR 299
            ||:.|    :||.:     :|..||:|:||:|...:.:|....|.:|:      |.........|
  Fly   241 FELFPETLLNLQDD-----LEKQGSDLAGVNADFTFRELKPTKEVKEEVDFQALSEKCANDENNR 300

Mouse   300 RLSGKDTEQIRETLRRGLEINSKPVLPPINSQRQNGLTHDRAPSRKDSLGSDSSTAIIPHELIRT 364
            :|:  ||:..||          :|..|...|...|.| |...|.        ...|..|:.:   
  Fly   301 QLT--DTQMKRE----------EPSFPQSMSMSSNSL-HKSCPL--------DFQAQAPNCI--- 341

Mouse   365 RQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATEEHPYAAHG 429
             .|:.:.:.........:.|.::.|:.||||||:|:  ..:|:|.|:..|.|:..|...||...|
  Fly   342 -SLDGIEITLAPGVAKYLLLAIKDRIRHGRHFTFKA--QHLALTLVAESVTGSAVTVNEPYGVLG 403

Mouse   430 PWLQILLTEEFVEKMLED-----LEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFDSP 483
            .|:|:|:.:|.|.:::||     |::...|:| :|  |..||:|.||      ::.|.|
  Fly   404 YWIQVLIPDELVPRLMEDFRSAGLDEKCEPKE-RL--ELEWPDKNLK------LIIDQP 453

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SufuNP_056567.2 SUFU 68..240 CDD:282876 89/184 (48%)
SUFU_C 254..474 CDD:289253 62/231 (27%)
Intrinsically disordered. {ECO:0000250|UniProtKB:Q9UMX1} 280..361 18/87 (21%)
Su(fu)NP_536750.2 SUFU 52..236 CDD:282876 89/184 (48%)
SUFU_C 250..450 CDD:289253 64/241 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C175966196
eggNOG 1 0.900 E1_28KPA
Hieranoid 1 1.000
Homologene 1 1.000 H9262
Inparanoid 1 1.050 305 1.000 Inparanoid score I2614
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0007903
OrthoInspector 1 1.000 T1084145
orthoMCL 1 0.900 OOG5_133643
Panther 1 1.100 LDO PTHR10928
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5422
TreeFam 1 0.960
1312.790

Return to query results.
Submit another query.