DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Nt5e and NT5E-2

Sequence 1:NP_035981.1 Gene:Nt5e MGIID:99782 Length:576 Species:Mus musculus
Sequence 2:NP_611218.1 Gene:NT5E-2 FlyBaseID:FBgn0050104 Length:585 Species:Drosophila melanogaster

Alignment Length:593 Identity:239/594 (40%)
Similarity:344/594 (58%) Gaps:55/594 (9%)


Mouse    10 KWLLLALSALLPQWPAAS--------AWELTILHTNDVHSRLEQTSDDSTKC----LNASLCVGG 62
            :||......:|..|..|:        |.|..|||.||:|:|.:|||.:|..|    ::.:.|.||
  Fly     4 RWLCGIFVIVLAHWTRANPILSHPKVATEFIILHNNDMHARFDQTSVNSGTCPPEDVHTNKCYGG 68

Mouse    63 VARLFTKVQQIRKEE----PNVLFLDAGDQYQGTIWFTVYKGLEVAHFMNILGYDAMALGNHEFD 123
            .||:..:|::.|||.    .:||:|:|||.|.||.|||::|....:.|:|.|..||::|||||||
  Fly    69 FARVAHEVRKYRKEAQEGGTSVLYLNAGDTYTGTSWFTIFKDKIASAFLNKLKPDAISLGNHEFD 133

Mouse   124 NGVEGLIDPLLRNVKFPILSAN--------IKARGPLAHQISGLFLPSKVLSVGGEVVGIVGYTS 180
            ..||||| |.|..|.||:|:.|        :||...||:        |.:|...|..||::||.:
  Fly   134 ERVEGLI-PFLNEVTFPVLACNLDLSKVPQLKATWHLAN--------SAILETNGTKVGVIGYLT 189

Mouse   181 KETPFLSNPGTNLVFEDEISALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDIVVGGH 245
            .:|..|: ...::.|.:|:.::..|..|||...:..||||||||:..|..||:....||||:|||
  Fly   190 PDTKKLT-LNMDVEFNEEVESINVEAKKLKAQGIKIIIALGHSGYLKDLEIAKNCPEVDIVIGGH 253

Mouse   246 SNTFLYTGNPPSKEVPAGKYPFIVTADDGRQVPVVQAYAFGKYLGYLKVEFDDKGNVITSYGNPI 310
            :|||||||..|..|...|.||.:|..:.|::||||||||:.||||.|.|:||..||:|...|:||
  Fly   254 TNTFLYTGAQPDAEHIDGPYPTMVKQNSGKEVPVVQAYAYTKYLGKLHVQFDADGNLIQWDGSPI 318

Mouse   311 LLNSSIPEDATIKADINQWRIKLDNYSTQELGRTIVYLDGSTQTCRFRECNMGNLICDAMINNNL 375
            |||:|:.::..:...:..:|..:.......:|.|.|:|:|:...||..|||:||||.|||:.:.|
  Fly   319 LLNASVAQEQDLLDLLEVFRPNVTRLEKSVVGHTKVHLEGNKAVCRAEECNLGNLIADAMVFSRL 383

Mouse   376 RHPDEM---FWNHVSMCIVNGGGIRSPIDEKNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKAF 437
            .  :|.   ||...::.|:.||||||.|:::::|.||..::.:|||:|....:|.:.|||:::|.
  Fly   384 M--EEQGGDFWTDAAISIMQGGGIRSSIEKRSDGAITDNDILSVLPWGNKLYMVPMTGSTIRRAL 446

Mouse   438 EHSVHRYGQ-STGEFLQVGGIHVVYDINRKPWNRVVQLEVLCTKCRVPIYEPLEMDKVYKVTLPS 501
            ||.....|: |.|.||||.||.||::.|:....|||.::|.|..||||.|..|....:|.|.|..
  Fly   447 EHGAALRGKDSDGGFLQVSGIRVVFNSNKPEGQRVVSVQVRCAACRVPTYSDLNDTAIYNVVLGE 511

Mouse   502 YLANGGDGFQMIKDELLKHDSGDQ-------DISVVSEYISKMKVVYPAVEGRIKF-SAASHYQG 558
            :|.:||||..|       .||..|       |:..||:|:::...|||.:||||.| :|:|...|
  Fly   512 FLLDGGDGHVM-------RDSAHQPQRLQNNDLEAVSQYLNQRDYVYPEIEGRIIFINASSTLMG 569

Mouse   559 SFPLVILS 566
            |..|:::|
  Fly   570 SAALLLIS 577

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Nt5eNP_035981.1 UshA 21..534 CDD:223808 222/548 (41%)
MPP_CD73_N 31..312 CDD:277354 132/297 (44%)
5_nucleotid_C 354..509 CDD:280945 68/159 (43%)
Substrate binding. {ECO:0000250} 502..508 3/6 (50%)
NT5E-2NP_611218.1 MPP_CD73_N 33..320 CDD:277354 132/297 (44%)
nadN 35..520 CDD:211667 210/497 (42%)
5_nucleotid_C 348..519 CDD:280945 73/173 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C280632989
eggNOG 1 0.900 E1_COG0737
Hieranoid 1 1.000
Homologene 1 1.000 H1895
Inparanoid 1 1.050 404 1.000 Inparanoid score I1888
Isobase 1 0.950 0 Normalized mean entropy S6498
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005290
OrthoInspector 1 1.000 T615289
orthoMCL 1 0.900 OOG5_127246
Panther 1 1.100 LDO PTHR11575
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5252
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.