DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dnajb6 and CG5001

Sequence 1:XP_006535770.1 Gene:Dnajb6 MGIID:1344381 Length:372 Species:Mus musculus
Sequence 2:NP_001245832.1 Gene:CG5001 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster

Alignment Length:178 Identity:79/179 (44%)
Similarity:105/179 (59%) Gaps:30/179 (17%)


Mouse     3 DYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAKKRDIYDK 67
            |||::||:.:.|:.::|||||||.||::|||||  ....||.|||:||||||||||..||::|||
  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDK 66

Mouse    68 YGKEGLNGGGGGGGIHFDSPFEFGFTFR---NPDDVFREFFGGRDPFS--FDFFEDPFD------ 121
            ||::||..||...|    .|....||::   :|...|.:|||..:||:  ||..::.||      
  Fly    67 YGEDGLKSGGTRNG----GPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDL 127

Mouse   122 ----DFFGNRRGPRGNRSRGAGSFFSTFSGFPSFGSGFPAFDTGFTPF 165
                |||.:..|..|:| .|.||.|.     |||.|  .:|:. .|||
  Fly   128 DTEPDFFSSPFGGIGSR-HGLGSGFR-----PSFRS--HSFNV-HTPF 166

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Dnajb6XP_006535770.1 DnaJ 2..>138 CDD:223560 68/150 (45%)
DnaJ 3..66 CDD:278647 38/63 (60%)
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 79/179 (44%)
DnaJ 4..65 CDD:278647 38/63 (60%)
DnaJ_C 174..338 CDD:199909
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C116999976
eggNOG 1 0.900 E1_COG0484
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.