DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FXN and fxn

DIOPT Version :8

Sequence 1:NP_000135.2 Gene:FXN / 2395 HGNCID:3951 Length:210 Species:Homo sapiens
Sequence 2:NP_001076485.1 Gene:fxn / 556389 ZFINID:ZDB-GENE-070209-286 Length:169 Species:Danio rerio

Alignment Length:183 Identity:94/184 (51%)
Similarity:116/184 (63%) Gaps:30/184 (16%)


Human    29 RPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLG-----HPG 88
            |....|.:|||.       ..|           .::|.|  |:.::|     ||.||     |..
Zfish    12 RSVSSANICGRH-------TQC-----------FDRILN--KRDLHL-----SGPLGEEKAHHLR 51

Human    89 SLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQ 153
            .:.|..||||||||||:||::||||.|:.:|..||||.|.:||||||:|.|.|||||||||||:|
Zfish    52 EISEAEYERLAEETLDALADYFEDLTDENFTGLDYDVVFSNGVLTVKVGSDHGTYVINKQTPNRQ 116

Human   154 IWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYS 206
            ||||||:||||||||||:.|||:||.|.||.||:.||:...||.:|||.|.:|
Zfish   117 IWLSSPTSGPKRYDWTGERWVYTHDAVPLHSLLSKELSIIFKTNIDLSHLIHS 169

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FXNNP_000135.2 mito_frataxin 94..192 CDD:132463 71/98 (72%)
fxnNP_001076485.1 Frataxin_Cyay 54..161 CDD:279789 74/107 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C246048371
eggNOG 1 0.900 E1_COG1965
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H47908
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1372185at2759
OrthoFinder 1 1.000 FOG0004540
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128372
Panther 1 1.100 LDO PTHR16821
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 1 1.500
99.300

Return to query results.
Submit another query.