DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FXN and fxn

DIOPT Version :9

Sequence 1:NP_000135.2 Gene:FXN / 2395 HGNCID:3951 Length:210 Species:Homo sapiens
Sequence 2:NP_001076485.1 Gene:fxn / 556389 ZFINID:ZDB-GENE-070209-286 Length:169 Species:Danio rerio


Alignment Length:183 Identity:94/183 - (51%)
Similarity:116/183 - (63%) Gaps:30/183 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    29 RPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLG-----HPG 88
            |....|.:|||.       ..|           .::|.|  |:.::|     ||.||     |..
Zfish    12 RSVSSANICGRH-------TQC-----------FDRILN--KRDLHL-----SGPLGEEKAHHLR 51

Human    89 SLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQ 153
            .:.|..||||||||||:||::||||.|:.:|..||||.|.:||||||:|.|.|||||||||||:|
Zfish    52 EISEAEYERLAEETLDALADYFEDLTDENFTGLDYDVVFSNGVLTVKVGSDHGTYVINKQTPNRQ 116

Human   154 IWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYS 206
            ||||||:||||||||||:.|||:||.|.||.||:.||:...||.:|||.|.:|
Zfish   117 IWLSSPTSGPKRYDWTGERWVYTHDAVPLHSLLSKELSIIFKTNIDLSHLIHS 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FXNNP_000135.2 mito_frataxin 94..192 CDD:132463 71/97 (73%)
fxnNP_001076485.1 Frataxin_Cyay 54..161 CDD:279789 74/106 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C194331916
Domainoid 1 1.000 161 1.000 Domainoid score I16507
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H47908
Inparanoid 1 1.050 171 1.000 Inparanoid score I11387
NCBI 1 1.000 - -
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1372185at2759
OrthoFinder 1 1.000 - - FOG0004275
OrthoInspector 1 1.000 - - oto45590
orthoMCL 1 0.900 - - OOG6_102217
Panther 1 1.100 - - LDO PTHR16821
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3009
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 1 1.500 - -
1414.400

Return to query results.
Submit another query.