DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FXN and Fxn

DIOPT Version :8

Sequence 1:NP_000135.2 Gene:FXN / 2395 HGNCID:3951 Length:210 Species:Homo sapiens
Sequence 2:NP_001178881.1 Gene:Fxn / 499335 RGDID:1565754 Length:206 Species:Rattus norvegicus

Alignment Length:208 Identity:146/209 (70%)
Similarity:161/209 (77%) Gaps:4/209 (2%)


Human     1 MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQI 65
            |||.||||.||||.. :.::|....|.||..|....||||||....:|... |.:..|...|.||
  Rat     1 MWTFGRRAAAGLLPR-TASRASAWVRNPRGRERIGTCGRRGLHVTANADAI-RHSHLNLHYLGQI 63

Human    66 WNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSG 130
            .|:|||||.:::||.|||||:|.|||||.||||||||||:||||||||||||||.:|||||||.|
  Rat    64 LNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDG 128

Human   131 VLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALK 195
            |||:|||||||||||||||||.:..||  .|||||||||||||||||||||||||||.|||:||.
  Rat   129 VLTIKLGGDLGTYVINKQTPNNEFILS--CSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALN 191

Human   196 TKLDLSSLAYSGK 208
            |||||||||||||
  Rat   192 TKLDLSSLAYSGK 204

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FXNNP_000135.2 mito_frataxin 94..192 CDD:132463 84/98 (86%)
FxnNP_001178881.1 mito_frataxin 92..188 CDD:132463 84/98 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C244922705
eggNOG 00.000 Not matched by this tool.
HGNC 1 1.500
Hieranoid 1 1.000
Homologene 1 1.000 H47908
Inparanoid 1 1.050 284 1.000 Inparanoid score I14485
OMA 1 1.010
OrthoDB 1 1.010 D1372185at2759
OrthoFinder 1 1.000 FOG0004540
OrthoInspector 1 1.000 T2473355
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR16821
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
1111.510

Return to query results.
Submit another query.