DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FXN and fh

DIOPT Version :8

Sequence 1:NP_000135.2 Gene:FXN / 2395 HGNCID:3951 Length:210 Species:Homo sapiens
Sequence 2:NP_511094.1 Gene:fh / 31845 FlyBaseID:FBgn0030092 Length:190 Species:Drosophila melanogaster

Alignment Length:185 Identity:77/186 (41%)
Similarity:105/186 (56%) Gaps:17/186 (9%)


Human    38 GRRGLRTDIDATC--TPRRASSNQRGLNQIWNVKKQSV---------YLMNLRK-SGTLGHPGSL 90
            ||..:|:.:...|  |..|.|..|...:|:......::         :..|.|. |..:....:|
  Fly     4 GRLMVRSIVGRACLATMGRWSKPQAHASQVILPSTPAIAAVAIQCEEFTANRRLFSSQIETESTL 68

Human    91 DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIW 155
            |..||||:..:|||:|.::||:|.:.....:..||::..|||||.|||..||||||:||||||||
  Fly    69 DGATYERVCSDTLDALCDYFEELTENASELQGTDVAYSDGVLTVNLGGQHGTYVINRQTPNKQIW 133

Human   156 LSSPSSGPKRYDWTGK----NWVYSHDGVSLHELLAAELTKALKTK-LDLSSLAY 205
            ||||:|||||||:.|.    .|:|.|.|.||||||..|:...||:: :|...|.|
  Fly   134 LSSPTSGPKRYDFVGTVAAGRWIYKHSGQSLHELLQQEIPGILKSQSVDFLRLPY 188

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FXNNP_000135.2 mito_frataxin 94..192 CDD:132463 58/102 (57%)
fhNP_511094.1 mito_frataxin 72..173 CDD:132463 58/101 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C247192986
eggNOG 1 0.900 E1_COG1965
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4534
Isobase 1 0.950 0 Normalized mean entropy S1580
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1372185at2759
OrthoFinder 1 1.000 FOG0004540
OrthoInspector 1 1.000 T1075431
orthoMCL 1 0.900 OOG5_128372
Panther 1 1.100 LDO PTHR16821
Phylome 1 0.910 0.974 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.710

Return to query results.
Submit another query.