DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FXN and SPCC1183.03c

DIOPT Version :8

Sequence 1:NP_000135.2 Gene:FXN / 2395 HGNCID:3951 Length:210 Species:Homo sapiens
Sequence 2:NP_587886.1 Gene:SPCC1183.03c / 2539143 PomBaseID:SPCC1183.03c Length:158 Species:Schizosaccharomyces pombe

Alignment Length:123 Identity:52/124 (42%)
Similarity:80/124 (65%) Gaps:4/124 (3%)


Human    72 SVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKL 136
            :|:.:..|....:.|.|:|.:..|.|:|::|||.|.:.||||.:: ...:|||:.:.:||:|:.|
pombe    24 NVFGLRCRYYSQVRHNGALTDLEYHRVADDTLDVLNDTFEDLLEE-VGKKDYDIQYANGVITLML 87

Human   137 GGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWT--GKNWVYSHDGVSLHELLAAELTK 192
             |:.||||||||.|..|||||||.||||.|:::  .|.|..:.|..:|..:|::|.:|
pombe    88 -GEKGTYVINKQPPAHQIWLSSPVSGPKHYEYSLKSKTWCSTRDEGTLLGILSSEFSK 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FXNNP_000135.2 mito_frataxin 94..192 CDD:132463 46/100 (46%)
SPCC1183.03cNP_587886.1 mito_frataxin 46..144 CDD:132463 46/100 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1860
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004540
OrthoInspector 1 1.000 T2523758
orthoMCL 1 0.900 OOG5_128372
Panther 1 1.100 LDO PTHR16821
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
87.920

Return to query results.
Submit another query.