DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FXN and fxn

DIOPT Version :8

Sequence 1:NP_000135.2 Gene:FXN / 2395 HGNCID:3951 Length:210 Species:Homo sapiens
Sequence 2:XP_017944796.1 Gene:fxn / 100497789 XenbaseID:XB-GENE-984730 Length:233 Species:Xenopus tropicalis

Alignment Length:195 Identity:112/196 (57%)
Similarity:132/196 (67%) Gaps:40/196 (20%)


Human    51 TPRRASSNQRGLNQIWNVK------------KQSVYLMNLRKSGTLGHPGSLDETTYERLAEETL 103
            |...:||..||. ||:.::            .::..|:..|.:|||.:..||||||||:||||||
 Frog    35 TAGSSSSQYRGF-QIFKIQTLQSFSHLLDPATRNSLLLCRRNAGTLSNTSSLDETTYEKLAEETL 98

Human   104 DSLAEFFEDLADKPYTFEDYDVSFG---------------------------SGVLTVKLGGDLG 141
            ||||||||||||:|:|.||||||||                           :||||||||||:|
 Frog    99 DSLAEFFEDLADQPFTPEDYDVSFGLQILNVLWAAAEKQNMGAISNHQAKNKNGVLTVKLGGDMG 163

Human   142 TYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYS 206
            ||||||||||||||||||:||||||||||:.||||||||:||||||.||:..||.|:|||:|.||
 Frog   164 TYVINKQTPNKQIWLSSPTSGPKRYDWTGRTWVYSHDGVALHELLAKELSAVLKNKIDLSNLLYS 228

Human   207  206
             Frog   229  228

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FXNNP_000135.2 mito_frataxin 94..192 CDD:132463 86/125 (69%)
fxnXP_017944796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H47908
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1372185at2759
OrthoFinder 1 1.000 FOG0004540
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.