DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Lamc3 and wb

Sequence 1:NP_035966.2 Gene:Lamc3 MGIID:1344394 Length:1581 Species:Mus musculus
Sequence 2:NP_723870.1 Gene:wb FlyBaseID:FBgn0261563 Length:3375 Species:Drosophila melanogaster

Alignment Length:1342 Identity:388/1343 (29%)
Similarity:548/1343 (41%) Gaps:383/1343 (29%)


Mouse    56 RAEAS--HTCGR-PPEDFCPHVGAPGAGLQCQRCDDADPGRRHDASYLTDFHSPDDS------TW 111
            ||:.|  .|||: ..|::|..|||...|: | ....:|..::.....|....|...|      .|
  Fly   163 RAQISVNATCGQNGAEEYCKQVGAKPCGI-C-NAHSSDRAKQRSIQSLISSGSGSGSGSGFEEGW 225

Mouse   112 WQSPSMAFGVQYPTSVNLTLSLGKAYEITYVRLKFHTS-RPESFAIYKRTYASGPWEPYQYY--- 172
            ||||::..|.|: ..|.:.|.|.:.::|..|.||...| ||.|: |.:::.....:||:||:   
  Fly   226 WQSPTLQGGRQF-EYVTILLDLKQTFQIFSVWLKSANSPRPASW-ILEKSLDGINFEPWQYFGLS 288

Mouse   173 SASCQKTY--GRPEGHYLRPGEDERVAFCTSEFSDISPLNGGNVAFSTLEGRPSAYNFEESPVLQ 235
            .|.||:.:  ....|.|:...:.|.:  |:::||...||..|.:..|.|:.||.|  .::||.|.
  Fly   289 DADCQRRWNLSGQNGKYVFQNDTEII--CSTQFSKPGPLENGVLHASLLKNRPGA--TDQSPELM 349

Mouse   236 EWVTSTDILISLDRLNTFG------DDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASECEPNAA 294
            :::|:..|.|.|..:::..      |.:...|.:.:..:|::|...|..|..|||||:....:..
  Fly   350 KFITTRYIRIRLQGMHSTANQDNSLDWLLDSPSLEKHSFYSLSQLKVSARLDCNGHANRSHESPD 414

Mouse   295 GQL-ACRCQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTGHG 358
            ..| .|.|||||.|..||:|.|.|||||:..|     .||..|.|.||:|.||:|..|.:     
  Fly   415 DPLMQCICQHNTCGAQCEQCCPLFQDRPYQMG-----GECEICQCYGHAESCTYDPFLDK----- 469

Mouse   359 GHCQRCRDHTTGPHCERCEKNYYRW--SPKT-PCQPCDCHPAGSLSLQCDNSGVCPCKPTVTGWK 420
            |.||.|.::|.|..||.||..:||.  :|.| ||.||.|:||.|......:.|.|.|.....|..
  Fly   470 GICQSCSNNTAGIECEFCEMGFYRELDAPLTDPCLPCSCNPARSTGGCQSDGGSCNCLEGFQGKN 534

Mouse   421 CDRCLPGFHSLSEGGCRPCACNVAGSLGTCDPRSGNCPCKENVEGSLCDRCRPGTFNLQPHNPVG 485
            |:.|.||::.   ..|:.|.|:..||||:....||.|.||.|||||.|..|.||.|:|...|..|
  Fly   535 CEECAPGYYG---DDCKRCECDERGSLGSTGSCSGVCQCKLNVEGSTCSECAPGYFDLSAENAEG 596

Mouse   486 CSSCFCYGHSKVCSPA----AGFQEHHIRSDFRHGAGGWQIRSMGVSKR---PLQWSQSGLLLGL 543
            |:||:|.|.|:.|..|    ..|:.          ...|:|..:...|.   |:....:.|:.  
  Fly   597 CTSCWCSGVSQTCHSAKLQTLAFET----------LNDWKITDIQRVKPISIPVDAETNRLIF-- 649

Mouse   544 RGGEEL--------SAPKKFLGDQRLSYGQ--PVILTLQVPPG---GSP---PPIQL-------- 584
              ..||        .|...:||::..|||.  .::|:..|..|   |.|   |.:.|        
  Fly   650 --ANELDEVEAIYWQASLGYLGNRLTSYGSRLQLVLSWDVIRGDRSGKPTTGPNVILVGKNGLKI 712

Mouse   585 -----RLEGAGLALSLRPSSL------PSPQDTRQPRR------------VQLQFLLQETSEEAE 626
                 .|:|.|:.|::..:.:      |:..|.:...|            .:.|||....|.:|.
  Fly   713 AFGDESLDGLGINLNVTLTEVGWYHVPPTVVDIKTRLRRTEGGDYHGESVTRSQFLSVLVSLDAV 777

Mouse   627 SPLPTFHFQRLLSNLTALSIWTSGQGPGHSGQVLLCEVQLTSAWPQRELAPPASWVETCLCPQGY 691
            .....||..:..::|....|::.|...|                     ...:|.||.||||.||
  Fly   778 LIRAAFHTDQGETSLERAVIYSGGVELG---------------------GKSSSQVEQCLCPAGY 821

Mouse   692 TGQFCEFCALGYKREIPHGGPY---ANCIPCTCNQH-GTCDPNTGIC-LCGHHTEGPSCERCMPG 751
            ||..||.||.|:||...:...:   :.||||.||.| .:||..:|.| .|.|:|.|..||||..|
  Fly   822 TGLSCEGCAFGFKRIYENTSDHQILSKCIPCPCNGHSNSCDLQSGNCGDCMHNTFGDRCERCQLG 886

Mouse   752 FYGNAFSGRADDCQPCPCP-------GQSACA-------------TIPESGDVVCTHCPPGQRGR 796
            :|||...|..:||:.|.||       ...:|.             .:.|..:.:||.||.|..|.
  Fly   887 YYGNPLQGTPNDCKRCACPLSEDSNNFSPSCQLKSYNYMDLNPQFELIEHAEYICTQCPEGYTGD 951

Mouse   797 RCESCEDGFFGDPLGLSGAPQP---CRRCQCSG-------------------------------- 826
            .|:.|:||:||:|      .||   |:||.|:|                                
  Fly   952 HCQVCDDGYFGNP------RQPGSSCQRCDCAGGPCNVTTGECITCRGNTEGWHCERCKLGYWGD 1010

Mouse   827 ----------------------------------------------NVDL-------NAVGN--- 835
                                                          ||:|       :.:|:   
  Fly  1011 PAVGCDPCHCHTEGSESGLCDSTDGQCLCKPRYAGQKCDECDVGYANVELRCPSCNCDPLGSLVQ 1075

Mouse   836 --CDPHSGHCLRCLYNTTGAHCEHCREGFYG-SAVATRPVD------------------------ 873
              ||||:|.| .|.....||.|..|::|::| :|||.|..|                        
  Fly  1076 DRCDPHTGQC-HCKEGVMGAKCHECQDGYFGMNAVAYRMDDLAALRQNSDSDDDEWELVPDTEDP 1139

Mouse   874 ------KCAPCSCDLRGSVSEKTCNPVTGQCVCLPYVSGRDCSRCSPGFYDLQSGRGCQSCKCHP 932
                  .|..|.|...||:| ..|:..||||.||..|:||.|.:|.||.::|.:|.||:.|:|.|
  Fly  1140 NSESTVACEECHCSSVGSLS-SDCDKRTGQCACLANVTGRRCDKCRPGHWNLTAGEGCRDCRCDP 1203

Mouse   933 LGSLENKCHPKTGQCPCRPGVTGQACDRCQLGFFGFSIK-------------------------- 971
            .||..::|:|.||||.|:.||.||.|:.|..||||||.:                          
  Fly  1204 HGSRGHECNPWTGQCDCKIGVGGQHCNECTEGFFGFSTEGCQRCSACRSEGQVCDPHNGRCICPK 1268

Mouse   972 ---------------------GCRDCRCSPLGAASSQCHE-NSTCVCRPGFVGYKCDRC------ 1008
                                 |||:|.|..:|:...||.. :..|.||.|:.|.|||.|      
  Fly  1269 FTRGLGCGQCVPGTWGWQARLGCRECECDHIGSIGQQCSTGDGQCQCREGYSGRKCDTCAIGYFG 1333

Mouse  1009 -----------QDNFFLADGDTGCQ---ECPTCYALVKEEAAKLKARLMLM----------EGWL 1049
                       :.:|..|||...|.   :|| |.:||    ..||....:.          || .
  Fly  1334 YPECRRCGCDAEGSFTQADGSIACDSNGQCP-CKSLV----VGLKCDTCMQSTFGLSAQNPEG-C 1392

Mouse  1050 QRSDCGSPWGPLDILQGEAPLGDVYQGHHLLQETRGTFLQQM 1091
            .|..|   :|    ..||....|:..||..:.|:|...:||:
  Fly  1393 TRCFC---FG----RSGECEQSDLSWGHIRMAESRNLSVQQI 1427

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Lamc3NP_035966.2 Laminin_N 53..278 CDD:278484 69/243 (28%)
EGF_Lam 279..326 CDD:238012 24/48 (50%)
Laminin_EGF 336..392 CDD:278482 26/59 (44%)
EGF_Lam 391..437 CDD:238012 15/46 (33%)
Laminin_EGF 439..486 CDD:278482 24/47 (51%)
Laminin_B 550..669 CDD:278481 31/158 (20%)
EGF_Lam 718..765 CDD:238012 24/49 (49%)
EGF_Lam 766..814 CDD:238012 18/68 (26%)
Laminin_EGF 822..>864 CDD:278482 19/132 (14%)
Laminin_EGF 878..925 CDD:278482 22/47 (47%)
Laminin_EGF 928..976 CDD:278482 27/95 (28%)
EGF_Lam 976..1022 CDD:238012 19/64 (30%)
Domain II and I 1025..1581 20/78 (26%)
Laminin_I 1225..1470 CDD:283627
GluZincin 1433..>1506 CDD:301352
wbNP_723870.1 Laminin_N 164..396 CDD:278484 67/240 (28%)
EGF_Lam 401..450 CDD:238012 25/54 (46%)
TNFRSF <407..507 CDD:304602 47/110 (43%)
EGF_Lam 505..552 CDD:238012 16/50 (32%)
Laminin_EGF 550..597 CDD:278482 24/47 (51%)
Laminin_B 660..798 CDD:278481 29/138 (21%)
EGF_Lam 851..900 CDD:238012 24/49 (49%)
Laminin_EGF <943..971 CDD:278482 13/34 (38%)
VSP 953..1414 CDD:146106 123/482 (26%)
Laminin_EGF 974..1018 CDD:278482 3/44 (7%)
EGF_Lam 1017..1065 CDD:238012 3/48 (6%)
Laminin_EGF 1065..>1105 CDD:278482 13/41 (32%)
EGF_Lam 1150..1197 CDD:238012 23/48 (48%)
Laminin_EGF 1199..1247 CDD:278482 24/48 (50%)
EGF_Lam 1247..1292 CDD:238012 2/45 (4%)
Laminin_EGF 1294..1342 CDD:278482 14/48 (29%)
Laminin_EGF 1340..1392 CDD:278482 14/58 (24%)
Laminin_B 1486..1611 CDD:278481
EGF_Lam 1669..1716 CDD:238012
Laminin_EGF 1718..1767 CDD:278482
EGF_Lam 1772..1819 CDD:238012
CrfC <1933..2267 CDD:223771
Laminin_II 2277..2400 CDD:283628
LamG 2399..>2492 CDD:304605
Laminin_G_2 2616..2755 CDD:280389
Laminin_G_2 2804..2944 CDD:280389
Laminin_G_2 3038..3169 CDD:280389
LamG 3192..3347 CDD:238058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1836
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.