DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ARHGAP8 and RhoGAP68F

Sequence 1:NP_001017526.1 Gene:ARHGAP8 HGNCID:677 Length:464 Species:Homo sapiens
Sequence 2:NP_001261744.1 Gene:RhoGAP68F FlyBaseID:FBgn0036257 Length:476 Species:Drosophila melanogaster

Alignment Length:395 Identity:139/396 (35%)
Similarity:207/396 (52%) Gaps:44/396 (11%)


Human    27 GDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKYTLDQYVENDYTIVYFHYGLNSRNKPSLGWLQ 91
            |.|:.||.:......|.|...:|: ..:.|.:| .::.:|||||.:||||.||...||||..:|.
  Fly   105 GTDKQGRHIFGIYASRFPEKSQLE-GFVREIIK-EIEPFVENDYILVYFHQGLKEDNKPSAQFLW 167

Human    92 SAYKEFDRKDGDLTMWPRLVSNSKLKRSSHLSLPKYWDYRYKKNLKALYVVHPTSFIKVLWNILK 156
            ::|||.||                               .::||||.|||||||.||:|:||...
  Fly   168 NSYKELDR-------------------------------NFRKNLKTLYVVHPTWFIRVIWNFFS 201

Human   157 PLISHKFGKKVIYFNYLSELHEHLKYDQLVIPPEVLRYDEKLQSLHEGRTPPPTKT-----PPPR 216
            |.||.||.||::|.:.|.||.:.|..::|.:|..:...|:||....:..||||:..     ....
  Fly   202 PFISDKFRKKLVYISSLDELRQALGLNKLKLPDNICDLDDKLNPSRKPSTPPPSSNINASRQQQH 266

Human   217 PPLPTQQFGVSLQYLKDKNQGEL--IPPVLRFTVTYLREKG-LRTEGLFRRSASVQTVREIQRLY 278
            ....|.||||.|:::. .|...|  |||::|..|..|...| :.|||:||||.:...:..::...
  Fly   267 KMATTHQFGVPLKFIV-MNSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERV 330

Human   279 NQGKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILR-SLP 342
            |:|:.|:.... ::|:.|.:||:|||:|.:|||||:.||.:.|........|.....|::| .||
  Fly   331 NRGEDVDLKSV-NVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKEERSRNVTQLIREKLP 394

Human   343 EHNYVVLRYLMGFLHAVSRESIFNKMNSSNLACVFGLNLIWPSQGVSSLSALVPLNMFTELLIEY 407
            |.||.:.:|::.||..|......|||.|||||.|||.|.:|.....:||..:.|:|.|.:.:::.
  Fly   395 EENYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLWSRSTSTSLEEIAPINAFVDFVLQN 459

Human   408 YEKIF 412
            ::.|:
  Fly   460 HKDIY 464

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ARHGAP8NP_001017526.1 SEC14 12..188 CDD:238099 59/161 (37%)
RhoGAP 222..412 CDD:295372 71/194 (37%)
RhoGAP68FNP_001261744.1 SEC14 105..233 CDD:238099 59/161 (37%)
RhoGAP-p50rhoGAP 269..464 CDD:239869 72/197 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 260 1.000 Inparanoid score I3072
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1511935at2759
OrthoFinder 1 1.000 FOG0001242
OrthoInspector 1 1.000 T610083
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45808
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
99.040

Return to query results.
Submit another query.