DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FOSL2 and kay

Sequence 1:XP_006712039.1 Gene:FOSL2 HGNCID:3798 Length:343 Species:Homo sapiens
Sequence 2:NP_001027577.2 Gene:kay FlyBaseID:FBgn0001297 Length:755 Species:Drosophila melanogaster

Alignment Length:412 Identity:100/413 (24%)
Similarity:143/413 (35%) Gaps:151/413 (37%)


Human     2 YQDYPGNFDTSSRGSSGSPAHAESYSSG--------GGGQQKF----RVDMPGSGSAFIPTINAI 54
            |.|...|.:..:..:|.:...:.||.:|        |||...|    .......|||.:.:.||.
  Fly   329 YNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMAGSVNGGGVNNFSNVLAAVSSSRGSASVGSSNAN 393

Human    55 TTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRR-RRDEQ 118
            |                 ||...|                    |.|         ||| .|...
  Fly   394 T-----------------SNTPAR--------------------RGG---------GRRPNRSTN 412

Human   119 LSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAIGPWQVAVPHIPLFPWQETEELEEEKSGL 183
            ::||||:||.:||||||.|||:||.||.:.|.:|.                 :|.|:||:....:
  Fly   413 MTPEEEQKRAVRRERNKQAAARCRKRRVDQTNELT-----------------EEVEQLEKRGESM 460

Human   184 QKEIAELQKEKEKLEFMLVAHGPVCKISPEERRS--------PPAPGLQPMRSGGG--------- 231
            :|||..|...|.:||::|..|...|:....:..|        .||..|....||.|         
  Fly   461 RKEIEVLTNSKNQLEYLLATHRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNS 525

Human   232 ---SVGAVV------------------------------VKQEPLEEDSPSSSSAGLD---KAQR 260
               |.|.:.                              :|.|||:....|.||...|   .::|
  Fly   526 NDSSNGTITGMDATLNSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKR 590

Human   261 SVIKPISIAGGFYGEEPLHTPIVVTSTPA-----VTPGTSNLVFTYPSVLEQESPASPSESCSKA 320
            ..:.|:|..      ..:|...::|.|.|     .||.||    |.|.......|.:.:.|    
  Fly   591 ITLPPMSTM------PHVHLSTILTPTGASSGSLQTPITS----TAPGGFGSAFPVTSNGS---- 641

Human   321 HRRSSSSGDQSSDSLNSPTLLA 342
               |.::.:...:::|||||.|
  Fly   642 ---SINNINSIGNNMNSPTLNA 660

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FOSL2XP_006712039.1 bZIP_Fos 134..204 CDD:269869 23/70 (33%)
coiled coil 134..203 CDD:269869 23/69 (33%)
kayNP_001027577.2 bZIP_Fos 420..481 CDD:269869 29/78 (37%)
coiled coil 421..480 CDD:269869 28/76 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1414
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000603
OrthoInspector 1 1.000 T608829
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23351
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R103
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.