DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: KAT6B and mof

Sequence 1:NP_001357065.1 Gene:KAT6B HGNCID:17582 Length:2073 Species:Homo sapiens
Sequence 2:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster

Alignment Length:691 Identity:202/692 (29%)
Similarity:309/692 (45%) Gaps:116/692 (17%)


Human   357 TSDEGS---------MNAFTGRGS-----------PGRGQKTKVCTTPSSGHAASGKDSSSRLAV 401
            |.||.|         :|.: |.||           |.....|:|.|.|:..|....:.....||.
  Fly   181 TEDEPSSDTVICVADINPY-GSGSNIDDFVMDPDAPPNAIITEVVTIPAPLHLKGTQQLGLPLAA 244

Human   402 -TDPTRPGATTKITTTSTYISASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPR 465
             ..|..|.|..::..|..                        :|:.||...  ..:..|.:.|.|
  Fly   245 PPPPPPPPAAEQVPETPA------------------------SPTDDGEEP--PAVYLSPYIRSR 283

Human   466 KKVSQKQSCTSHVLATGTTQKLKPPPS-SLPPPTPISGQSPSSQKSSTATSSPSPQSSSSQCSVP 529
            ..........:.:......|:..|||: .||..|.:|....:....|:.|||........:....
  Fly   284 YMQESTPGLPTRLAPRDPRQRNMPPPAVVLPIQTVLSANVEAISDDSSETSSSDDDEEEEEDEDD 348

Human   530 SLSSLTTNSQLKALFDGLSHIYTTQGQSRKKGHPSYAPPKRMRRKTELSSTAKSKAHFFGKRD-- 592
            :|:              :.|..|::......|.|       :.:|.::|.. ..|.:|..:.|  
  Fly   349 ALT--------------MEHDNTSRETVITTGDP-------LMQKIDISEN-PDKIYFIRREDGT 391

Human   593 ------IRSRFISHSSSSSWGMARGSIFKAIAHF-----KRTTFLKKHRM------LGRLKYKVT 640
                  ::||...::::..         :...|:     :...::.:||:      ||.:.....
  Fly   392 VHRGQVLQSRTTENAAAPD---------EYYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPA 447

Human   641 PQMGTPSP------------GKGSLTDGRIKPDQDDDTEIKI--NIKQESADVNVIGNKDVVTEE 691
            |.:....|            ...:.:..|.|...:.|..:..  |.:.:.:|..:...:....:|
  Fly   448 PPLAPDQPSTSREMLAQQAAAAAAASSERQKRAANKDYYLSYCENSRYDYSDRKMTRYQKRRYDE 512

Human   692 DLDVFKQAQELSWEKIECESGVEDCG--RYPSVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFC 754
            ...|.|...||:..:...|...|...  :|...::||.|||.|||.||:|:||.:...||:||:|
  Fly   513 INHVQKSHAELTATQAALEKEHESITKIKYIDKLQFGNYEIDTWYFSPFPEEYGKARTLYVCEYC 577

Human   755 LKYMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYY 819
            ||||:.::....|..:|....||..||||:.::|::||:|....:|||.|||:||||||||.||:
  Fly   578 LKYMRFRSSYAYHLHECDRRRPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVLYF 642

Human   820 DVEPFLFYVLTKNDEKGCHLVGYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRRE 884
            |::|||||:|.:.|::|.|:||||||||...:.|||:||:::|.|||:|||:.||.|||.|||:|
  Fly   643 DMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSRKE 707

Human   885 GQAGSPEKPLSDLGRLSYLAYWKSVILEYLYHH-HERHISIKAISRATGMCPHDIATTLQHLHMI 948
            |..|||||||||||||||.:||...:||.:... ....|:||.:|..:|:...||..|||.:.||
  Fly   708 GVIGSPEKPLSDLGRLSYRSYWAYTLLELMKTRCAPEQITIKELSEMSGITHDDIIYTLQSMKMI 772

Human   949 DKRDGRFVIIRREKLILSHMEKLKTCSRANELDPDSLRWTP 989
            ....|:.||....|.|..|::..:.......:|.|.|.|:|
  Fly   773 KYWKGQNVICVTSKTIQDHLQLPQFKQPKLTIDTDYLVWSP 813

Known Domains:


GeneSequenceDomainRegion External IDIdentity
KAT6BNP_001357065.1 Negatively regulates HAT activity 361..717 66/411 (16%)
Catalytic 718..1008 133/274 (49%)
Interaction with BRPF1. {ECO:0000269|PubMed:18794358} 752..1008 116/240 (48%)
Acetyl-CoA binding. {ECO:0000250|UniProtKB:Q92794} 856..860 2/4 (50%)
Acetyl-CoA binding. {ECO:0000250|UniProtKB:Q92794} 865..871 5/6 (83%)
Interaction with RUNX1 and RUNX2. {ECO:0000269|PubMed:11965546} 1560..2073
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 7/59 (12%)
NAT_SF 528..813 CDD:302625 134/285 (47%)
MOZ_SAS 599..778 CDD:280097 98/179 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.