DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Slc36a4 and CG32081

Sequence 1:NP_758493.2 Gene:Slc36a4 MGIID:2442595 Length:500 Species:Mus musculus
Sequence 2:NP_729646.1 Gene:CG32081 FlyBaseID:FBgn0052081 Length:471 Species:Drosophila melanogaster

Alignment Length:476 Identity:135/477 (28%)
Similarity:234/477 (49%) Gaps:66/477 (14%)


Mouse    54 HGISFLQTLVHLLKGNIGTGLLGLPLAIKNAGIVLGPISLVFIGIISVHCMHILVRCSHFLCQRF 118
            |.||.:.....|||..:|||::.:||:...||||.|.|.||.:..:.:|.|.:|:.|. ..|.| 
  Fly    17 HPISDIGAFFSLLKCVVGTGVMAIPLSFNYAGIVTGIILLVSVCFMLIHGMQMLIICM-IECSR- 79

Mouse   119 KKSTLGYSD---TVSFAMEASP--WSCLQRQAAWGRSVVDFFLVITQLGFCSVYIVFLAENVKQV 178
             :..:||:.   .:.::.:..|  :..:.:.   ||.:||..|..:|.|.|.||.||:|..:||:
  Fly    80 -RMQIGYATYPVAMVYSFDQGPRFFKYISKA---GRYIVDGVLAFSQFGVCVVYNVFVAATLKQL 140

Mouse   179 HEGFLGSTPIVSNGSDLSHACERRSVDLRVYM----LCFLPLIILLVFIRELKNLFVLSFLANIS 239
            .:.:.    :|:              |||:|:    ||.:|..    .||:||.|...:.||:|.
  Fly   141 VDFYW----VVA--------------DLRIYIAVIALCLIPPF----QIRKLKYLVPFNILASIL 183

Mouse   240 MAASLVIIYQYVVRNMPDPHNLPIVAG-WKKYPLFFGTAVFAFEGIGVVLPLENQMRESKRFP-- 301
            :.....::..|:..::|......|:.| ..|.|||||.|:|:...:||:|.:|..|.:.:.:.  
  Fly   184 IYTGFSLMMYYLFVDLPPITERNILFGRIDKIPLFFGIALFSITSVGVMLAVEATMAKPRHYLGW 248

Mouse   302 -QALNIGMAIVTVLYISLATLGYMCFRDEIKGSITLNLPQDMWLYQSVKILYSFGIFVTYSIQFY 365
             ..|:..:.:|.:.|::...:||..:.||..|||:||:|.|..|.|..|...:..||:||.:..:
  Fly   249 FGILDRAILLVIISYVTFGLMGYWRYGDETAGSISLNIPTDEVLSQVAKGFIAAAIFLTYPLAGF 313

Mouse   366 VPAEIIIPGVTARLHAKWKR--------ICEFGIRSLLVSITCAGAILIPRLDIVISFVGAVSSS 422
            |..:||       ::..|.:        :.|..:|:..|.:.|..||:.|.|..::|.|||::.|
  Fly   314 VIIDII-------MNHFWNKNGDLPNAALKESILRACTVVLICITAIIAPNLGPLLSLVGALTIS 371

Mouse   423 TLALILPPLVEILTFSKDHYNI----WMILKNISIAFTGVVGFLLGTYVTVEEIIY------PTT 477
            .|.|:.|.|:||..:....||.    |:::|:|.....|::..:.||..:::::|.      .||
  Fly   372 LLNLVFPALIEICLYYPPEYNYGKLKWVLVKDIFYVIVGILILVQGTVFSIKDMISEWGGGDTTT 436

Mouse   478 AVVAGTSQSPFLNVNSTCITS 498
            .....|::....|:::|..|:
  Fly   437 GGPETTAEETTANMSATLTTA 457

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Slc36a4NP_758493.2 SLC5-6-like_sbd 54..469 CDD:294310 128/440 (29%)
CG32081NP_729646.1 SLC5-6-like_sbd 17..422 CDD:294310 128/440 (29%)
SdaC 20..415 CDD:223884 124/430 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96458968
eggNOG 1 0.900 E1_COG0814
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000215
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22950
Phylome 1 0.910 0.889 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.