DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NOMO1 and CG1371

Sequence 1:NP_055102.3 Gene:NOMO1 HGNCID:30060 Length:1222 Species:Homo sapiens
Sequence 2:NP_610551.1 Gene:CG1371 FlyBaseID:FBgn0033482 Length:1199 Species:Drosophila melanogaster

Alignment Length:1249 Identity:397/1250 (32%)
Similarity:627/1250 (50%) Gaps:131/1250 (10%)


Human    19 VVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPLY 83
            |:||:.....|:..|..|||||||:||..||::|.:||||.||.|:||.:|||:|:|||:.:|:|
  Fly     9 VILLIKLFQNANAGEVEVVGCGGFIKSHAEIDFSRVEIKLLTKQGSLKDKTDCSPSNGYYFLPIY 73

Human    84 DKGDFILKIEPPLGWSFEPTTVELHVDGVSDICTKGGDINFVFTGFSVNGKV-LSKGQPLGPAGV 147
            ||||::|.|.||.||||||..|||:.||.:|:|::|.|:||||.||.:.|:| |:.|.  |..||
  Fly    74 DKGDYLLSISPPPGWSFEPEQVELNFDGKTDVCSQGRDVNFVFKGFGITGQVALAAGG--GARGV 136

Human   148 QVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGDYEILATHPTWALKEASTTVRVTNSNAN-AASP 211
            .|.||:  .:.:::.|.:...|.|:|..::||:|.:.|:|..|...:|...|.|.:.|.. .|:.
  Fly   137 DVELRS--EQGEVRRTKSDANGVFSFTPIIPGNYVVKASHARWHFSKAEHKVVVVSGNTELPANS 199

Human   212 LIVAGYNVSGSVRSDGEPMKG-VKFLLF----SSLVTKEDVLGCNV-SPVPGFQPQDESLVY--- 267
            |:|:|::|.|...| ..|:.| :...|:    .|||.|     |.. ||.|   |...:..|   
  Fly   200 LVVSGFDVVGRFDS-SSPLPGNLGVALYKKKGQSLVPK-----CETSSPAP---PNSVNSAYESA 255

Human   268 -LCYTVSREDGSFSFYSLPSGGYTVIPFYRGERITFDVAPSRLDFTVEHDSLKIEPVFHVMGFSV 331
             .|::...:.|.:.|.::|||.|.:.......::...::|..|:..|..|:|:|:..|.:.||:|
  Fly   256 SSCFSQLDKSGEYIFKNVPSGKYLLQAINLDSKLKLHLSPELLELEVGKDTLQIKDEFKITGFTV 320

Human   332 TGRVLNGPEGDGVPEAVVTLNNQIKVKTKADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPN 396
            :||||....|:.:..||:.:|.:...:|.|.||:.|||:..||..|..:...|.|..:.:|...|
  Fly   321 SGRVLTSAGGEPLKSAVIKVNGKKVAETDAQGSYTLENLKAGTVNIEVESSQLQFSPLQVKAQIN 385

Human   397 TPQLADIIATGFSVCGQISIIRFPDTVKQMNKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGT 461
            |..|..|:.:.:.|||::.      :.|..|.....:.|.....:....||   |::|.....|.
  Fly   386 TASLPTIVPSAYEVCGKVV------SPKSHNVGLTKIGSTFHSSASTNAET---GNWCAFLPVGK 441

Human   462 YKVQVMVPEAETRAGLTLKPQTFPLTVTNRPMMDVAFVQFLASVSGKVSCLD----TCGDLLVTL 522
            |.::|:..:|:..||:...|......|.:.|:..:.|.|..|.:.|::.||.    ||....|||
  Fly   442 YTIEVLTTDADKAAGVQFFPVQQQTEVRDAPVNGITFSQLRAKIRGELQCLPDATATCTSAEVTL 506

Human   523 QSLSRQGEKRSLQLSGKVNAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDMSAVEFRQ 587
            |:|...|:....:...:.:...:.|.::|||.|:::|...:.|:::..:.:.|...:..|..|..
  Fly   507 QALDATGQPTENKWKARAHRGKYVFKDMLPGPYELTIPQGNLCYESTRVFLNVASAEEDAPPFVH 571

Human   588 TGYMLRCSLSHAITLEF-YQDGNGRENVGIYNL--SKGVNRFCLSKPGVYKVTPRSCHRFEQAFY 649
            .||.:....||...::: :..|.........:|  :.|||.||:.|.|.|......||       
  Fly   572 KGYEVSIISSHRALMKYTHVTGPSEPKAPTESLKIASGVNTFCVKKYGSYDFKLEGCH------- 629

Human   650 TYDTSSPS-----------ILTLTAIRHHV-LGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSV 702
            |||.|.||           .|.:.|:.|.. :..::|:...|   :||..::||..         
  Fly   630 TYDESLPSKFITPEPDQLQTLIINAVAHKTGVRVLSTEPTAD---SIKLVLESESL--------- 682

Human   703 QELRREQQLAEIEARRQEREKNGNEEGEERMTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTP 767
                                      |:|.:|  ||.|. .::.|.|:|.:..:.:..:.:.:||
  Fly   683 --------------------------GQEVIT--PVAES-HKVDGKFAYRYDTYLKPEQVLRITP 718

Human   768 SSKELLFYPPSMEAVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVIS---EKGASSPLIT 829
            .|..|||.|...| :|....|...........||.|.|::.|.::..:|.:|   :....|  :.
  Fly   719 VSDVLLFAPQQHE-IVGSSDCVDIAFNFVATRGLILRGKVVPAIKDAKITLSFPDQPELES--LE 780

Human   830 VFTDDKGAYSVGPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVL 894
            |.|...|.:..||:...|.:.:.::||.||.:........|.|:.|..:|..:|.|..|.|.|||
  Fly   781 VLTSVTGEFKFGPIEESLAFDLKAEKESYVFSDYNRQTASFSAHKLCEISVVVKDEAGQTLGGVL 845

Human   895 LSLSGG-LFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYR 958
            |||||| .:|.||:|.|||.:.|.:|||.|||.:|||||::|||:|:||::::|:.:.:|:.|.|
  Fly   846 LSLSGGESYRKNLVTGDNGAINFHSLSPSQYYLRPMMKEYKFEPNSKMIDIKDGETVSVTLVGKR 910

Human   959 TAYSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGN 1023
            .|||.:||||||||:|..||.::|...|.|....|:..::..|::|:|||.|||.|.|::..: .
  Fly   911 FAYSIFGTVSSLNGDPFAGVNVQATADNSCPQQPEEATSEANGQYRIRGLQPGCSYSVRVVPD-K 974

Human  1024 DHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNV-ITSSEYLPTLWVKLYKSENLDNPI 1087
            :.:||::|....::|.|.|:.|:|::....:...|::..| .|.:|:..||.:.:|:..|.|:|:
  Fly   975 EIVERSIPAQHTVKVANEDVRDINLVAISPLKIVDITARVTATLNEHYKTLRIVMYRKGNSDSPV 1039

Human  1088 --QTVS--------LGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKHIT 1142
              |.|.        |...:...||.:..||::|||.|.|||....|.|.||..:|.|......:.
  Fly  1040 FSQRVGTPVNPKARLNPGITVFFPRIPLDGKSYVVELQSTLSDKTYTYKLPSTTFVADRGSVFVE 1104

Human  1143 LIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASDNSGP 1207
            |.|.|..:..|.|:.|.|..||.|..||.:|.:..|.....|..:.|:|..|.|           
  Fly  1105 LEFKPEVRAAEADLNQNSISALVLIALVAIAFFKQDLATSFLSFVWSKLNDVAA----------- 1158

Human  1208 EDAKRQAKKQKTRR 1221
            :.|:||..|.:.|:
  Fly  1159 DLAQRQKSKTQVRK 1172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NOMO1NP_055102.3 CarboxypepD_reg 130..>188 CDD:290350 19/59 (32%)
CarboxypepD_reg 330..403 CDD:290350 25/73 (34%)
Cna_B 875..>927 CDD:283411 29/53 (55%)
CarboxypepD_reg 965..1048 CDD:290350 33/83 (40%)
CG1371NP_610551.1 CarboxypepD_reg 120..198 CDD:290350 25/82 (30%)
CarboxypepD_reg 319..>370 CDD:290350 19/51 (37%)
Peptidase_M14NE-CP-C_like 841..905 CDD:304370 36/64 (56%)
CarboxypepD_reg 914..>970 CDD:290350 26/56 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C329766015
eggNOG 1 0.900 E1_KOG1948
Hieranoid 1 1.000
Homologene 1 1.000 H13810
Inparanoid 1 1.050 609 1.000 Inparanoid score I907
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D361344at33208
OrthoFinder 1 1.000 FOG0003154
OrthoInspector 1 1.000 T608427
orthoMCL 1 0.900 OOG5_132415
Panther 1 1.100 LDO PTHR23303
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3347
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.