DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PUM2 and pum

Sequence 1:NP_001339846.1 Gene:PUM2 HGNCID:14958 Length:1066 Species:Homo sapiens
Sequence 2:NP_001262403.1 Gene:pum FlyBaseID:FBgn0003165 Length:1533 Species:Drosophila melanogaster

Alignment Length:1255 Identity:505/1256 (40%)
Similarity:617/1256 (49%) Gaps:371/1256 (30%)


Human     7 ALALESRGMGELLPT-KKFWEPDD------STKDGQ------KGIFLGDDE--WRETAWGASHHS 56
            |:|..:|.......| ||.||..|      ||..|.      .||  ||..  |::..|.    :
  Fly   363 AVAAANRNAAITTSTAKKLWEKSDGKGVSSSTPGGPLHPLQIPGI--GDPSSVWKDHTWS----T 421

Human    57 MSQPIMVQRRSGQGFHG------NSEVNAILSPRSESGGLGVSMVEYVLSSSPADK------LDS 109
            ..:.|:|...|....||      ||....|||||..:   ...:||||.|.||.:|      |:.
  Fly   422 QGENILVPPPSRAYAHGGASDTSNSGNAGILSPRDST---CAKVVEYVFSGSPTNKDSSLSGLEP 483

Human   110 RFRKGNFGTRDAETDGPEKGDQKGKASPFEEDQNRDLKQGDDDDSKINGRGLPNGMDADCKDFNR 174
            ..|...|...|...|..||.:     |||:   ...||:   ||...|..|:.||:|.| |.|||
  Fly   484 HLRNLKFDDNDKSRDDKEKAN-----SPFD---TNGLKK---DDQVTNSNGVVNGIDDD-KGFNR 536

Human   175 TPGSRQASPTEVVERLGPN------------TNPSEGLG-------------------------- 201
            ||||||.||.|..:...||            .:..:|:|                          
  Fly   537 TPGSRQPSPAEESQPRPPNLLFPPLPFNHMLMDHGQGMGGGLGGVVGSGNGVGGGSGGGGAGGAY 601

Human   202 ---------------PLPN-------PTANKPLVEEFSNPETQNLDAMEQVG--LESLQFDY--- 239
                           |:.|       ..|..|::    |.:....:.||..|  |:...||.   
  Fly   602 AAHQQMAAQMSQLQPPMMNGVGGGMPMAAQSPML----NHQAAGPNHMESPGNLLQQQNFDVQQL 662

Human   240 -----PG----------------NQVPMDSSGATVG--------LFDYNSQQQLFQRTNALTVQQ 275
                 ||                ......|:.|.||        |.....|||          ||
  Fly   663 FRSQNPGLAAVATNAAAAAAAAAAATSAASAAAAVGAPPVPNGSLQQSQQQQQ----------QQ 717

Human   276 LTAAQQQQYALAAAQQPHIAGVFSA-GLAPAAFVPNPYIISAAPPGTDPYTAAGLAAAATLAGPA 339
            ....||||..:|||.|..:|....| ..|.||.....|:|:   ||.:.....|:.|||.:    
  Fly   718 QQQQQQQQMHMAAASQQFLAAQQQAQNAAYAAQQATSYVIN---PGQEAAPYMGMIAAAQM---- 775

Human   340 VVPPQYYGV-PWGVYPANLFQQQAAAAANNTASQQAASQAQPGQQQVLRAGAGQRPLTPNQGQQG 403
                .|||| |||:||.||..||.               .||           :|||||:|    
  Fly   776 ----PYYGVAPWGMYPGNLIPQQG---------------TQP-----------RRPLTPSQ---- 806

Human   404 QQAESLAAAAAANPTLAFGQGLATGMPGYQVLAPTAYYDQTGALVVGPGARTGLGAPVRLMAPTP 468
                               || |...| |||:  .|:.|.||:|::| |.||  |.|:||::|.|
  Fly   807 -------------------QG-AENQP-YQVI--PAFLDHTGSLLMG-GPRT--GTPMRLVSPAP 845

Human   469 VLISSAAAQAAAAAAAGGTASSLTGSTNGLFRPIGTQPPQQQQQQPST---NL---QSNSFYGSS 527
            ||:...|.:|.                     |...|.||..|.||.|   ||   |:.|..|..
  Fly   846 VLVPPGATRAG---------------------PPPPQGPQLYQPQPQTAQQNLYSQQNGSSVGGL 889

Human   528 SLTNSS---------QSSSLFSHGPGQPGSTSLGFGSGNSLGAAIGSALSGFGSSVGSSASSSAT 583
            :|..||         :|:|.||  |.....||.|.       ||..:|::...:...::|:::|.
  Fly   890 ALNTSSLTGRRDSFDRSTSAFS--PSTMDYTSSGV-------AAAANAVNSTVAQAAAAAAAAAA 945

Human   584 RRESLSTSSDLYKRSSSSLAPIGQPFYNSLGF-SSSPSPIGMPLPSQTPGHSLTPPPSLSSHGSS 647
            .|          .:...:::......|.:||. ::|.||:|.|         :||||      |:
  Fly   946 AR----------GKWPGAMSGAASGAYGALGAGNASASPLGAP---------ITPPP------SA 985

Human   648 SSLHLGGLTNGSGRYISAAPGAEAKYRS----------------------ASSTSSLFSSSSQLF 690
            .|..||          |.|||||::.|.                      |::.:::|.|:|.:|
  Fly   986 QSCLLG----------SRAPGAESRQRQQQQQQLAAVGLPATAAAAQAAVAAAANNMFGSNSSIF 1040

Human   691 ---------------PPSRLRYNRSDIMPS--------------------GRSRLLEDFRNNRFP 720
                           ..:....|...:..:                    |||||||||||.|:|
  Fly  1041 SNPLAIPGTAAVAAAAAAAAAANSRQVAATAAAAAAVAAAAGGVGGAPQPGRSRLLEDFRNQRYP 1105

Human   721 NLQLRDLIGHIVEFSQDQHGSRFIQQKLERATPAERQMVFNEILQAAYQLMTDVFGNYVIQKFFE 785
            |||||||..|||||||||||||||||||||||.||:||||:|||.|||.||||||||||||||||
  Fly  1106 NLQLRDLANHIVEFSQDQHGSRFIQQKLERATAAEKQMVFSEILAAAYSLMTDVFGNYVIQKFFE 1170

Human   786 FGSLDQKLALATRIRGHVLPLALQMYGCRVIQKALESISSDQQVISEMVKELDGHVLKCVKDQNG 850
            ||:.:||..|..:::||||.|||||||||||||||||||.:||  .|:|.|||||||||||||||
  Fly  1171 FGTPEQKNTLGMQVKGHVLQLALQMYGCRVIQKALESISPEQQ--QEIVHELDGHVLKCVKDQNG 1233

Human   851 NHVVQKCIECVQPQSLQFIIDAFKGQVFVLSTHPYGCRVIQRILEHCTAEQTLPILEELHQHTEQ 915
            |||||||||||.|.:|||||:||||||:.|||||||||||||||||||||||.|||:|||:||||
  Fly  1234 NHVVQKCIECVDPVALQFIINAFKGQVYSLSTHPYGCRVIQRILEHCTAEQTTPILDELHEHTEQ 1298

Human   916 LVQDQYGNYVIQHVLEHGRPEDKSKIVSEIRGKVLALSQHKFASNVVEKCVTHASRAERALLIDE 980
            |:||||||||||||||||:.||||.:::.:|||||.||||||||||||||||||:|.||..||||
  Fly  1299 LIQDQYGNYVIQHVLEHGKQEDKSILINSVRGKVLVLSQHKFASNVVEKCVTHATRGERTGLIDE 1363

Human   981 VCCQNDGPHSALYTMMKDQYANYVVQKMIDMAEPAQRKIIMHKIRPHITTLRKYTYGKHILAKLE 1045
            ||..||   :||:.||||||||||||||||::||.|.|.:|.|||||:..||||||||||.||||
  Fly  1364 VCTFND---NALHVMMKDQYANYVVQKMIDVSEPTQLKKLMTKIRPHMAALRKYTYGKHINAKLE 1425

Human  1046 KYYLK--NSPDLGP-IGGPP 1062
            |||:|  |...:|. .||.|
  Fly  1426 KYYMKITNPITVGTGAGGVP 1445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PUM2NP_001339846.1 Interaction with SNAPIN. {ECO:0000269|PubMed:19168546} 1..260 93/374 (25%)
Pumilio 721..1044 CDD:153420 256/323 (79%)
Pumilio 1. {ECO:0000255|PROSITE-ProRule:PRU00317, ECO:0000269|PubMed:21397187} 726..761 31/35 (89%)
Adenine-nucleotide binding in RNA target. {ECO:0000250|UniProtKB:Q14671} 741..745 4/4 (100%)
Pumilio 2. {ECO:0000255|PROSITE-ProRule:PRU00317, ECO:0000269|PubMed:21397187} 762..797 27/35 (77%)
Uracil-nucleotide binding in RNA target. {ECO:0000250|UniProtKB:Q14671} 777..781 4/4 (100%)
Pumilio 3. {ECO:0000255|PROSITE-ProRule:PRU00317, ECO:0000269|PubMed:21397187} 798..835 27/37 (73%)
Adenine-nucleotide binding in RNA target. {ECO:0000250|UniProtKB:Q14671} 813..817 4/4 (100%)
Pumilio 4. {ECO:0000255|PROSITE-ProRule:PRU00317, ECO:0000269|PubMed:21397187} 836..871 32/35 (91%)
Non-specific-nucleotide binding in RNA target. {ECO:0000250|UniProtKB:Q14671} 851..855 4/4 (100%)
Pumilio 5. {ECO:0000255|PROSITE-ProRule:PRU00317, ECO:0000269|PubMed:21397187} 872..907 32/35 (91%)
Adenine-nucleotide binding in RNA target. {ECO:0000250|UniProtKB:Q14671} 887..891 4/4 (100%)
Pumilio 6. {ECO:0000255|PROSITE-ProRule:PRU00317, ECO:0000269|PubMed:21397187} 908..943 28/35 (80%)
Uracil-nucleotide binding in RNA target. {ECO:0000250|UniProtKB:Q14671} 923..927 4/4 (100%)
Pumilio 7. {ECO:0000255|PROSITE-ProRule:PRU00317, ECO:0000269|PubMed:21397187} 944..979 28/35 (80%)
Guanine-nucleotide binding in RNA target. {ECO:0000250|UniProtKB:Q14671} 959..963 4/4 (100%)
Pumilio 8. {ECO:0000255|PROSITE-ProRule:PRU00317, ECO:0000269|PubMed:21397187} 983..1022 25/39 (64%)
Uracil-nucleotide binding in RNA target. {ECO:0000250|UniProtKB:Q14671} 1002..1006 4/4 (100%)
pumNP_001262403.1 Pumilio 1106..1424 CDD:153420 256/323 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C179657
eggNOG 1 0.900 E1_COG5099
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 640 1.000 Inparanoid score I800
Isobase 1 0.950 0 Normalized mean entropy S1682
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001010
OrthoInspector 1 1.000 T608850
orthoMCL 1 0.900 OOG5_126869
Panther 1 1.100 LDO PTHR12537
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1032
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1211.730

Return to query results.
Submit another query.