DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ATP11A and CG33298

Sequence 1:XP_005268356.1 Gene:ATP11A HGNCID:13552 Length:1192 Species:Homo sapiens
Sequence 2:NP_995666.1 Gene:CG33298 FlyBaseID:FBgn0032120 Length:1517 Species:Drosophila melanogaster

Alignment Length:1346 Identity:405/1347 (30%)
Similarity:637/1347 (47%) Gaps:276/1347 (20%)


Human    24 RTIYVGHREPPPGAEAYIPQ-RYPDNRIVSSKYTFWNFIPKNLFEQFRRVANFYFLIIFLVQLII 87
            ||:...|..||...:...|. ::..|:|.::|||..:||||||.|||.||||.||:.|.|:..: 
  Fly   228 RTVVPNHTVPPKTPKRDHPNGQFVGNKIRTTKYTLLSFIPKNLLEQFHRVANLYFIFIVLLNWV- 291

Human    88 DTPTSPVTSG-------LPLFFVITVTAIKQGYEDWLRHKADNAMNQ--CPVHFIQHGKLVRKQS 143
                 |..|.       :|:.||:.|||:|..:||..|..:|..:|.  |.|:..:..:..:.:.
  Fly   292 -----PEISAFGKEVAMIPVLFVLGVTAVKDLFEDRRRRASDKRINNTTCRVYDGETERYKKVKW 351

Human   144 RKLRVGDIVMVKEDETFPCDLIFLSSNRGDGTCHVTTASLDGESSHKTHYAVQDTKGFHTEEDI- 207
            ::|||||||.:..:||.|.|::.|.::...|.|::.|..||||::.|....|   :||...:.| 
  Fly   352 QELRVGDIVHLSNNETVPADILLLRTSDPQGVCYIDTCDLDGETNLKRREVV---RGFEEMQSIF 413

Human   208 --GGLHATIECEQPQPDLYKFVGRINVYSDLNDPVVR-PLGSENLLLRGATLKNTEKIFGVAIYT 269
              ....:.:|.:.|...||:|.|.:     ::....| |:.:|.||||.:.||||:.|.|:.:|.
  Fly   414 VPSKFVSRVEADAPTTKLYRFHGAL-----IHPTGERVPISTECLLLRESRLKNTDYIEGIVVYA 473

Human   270 GMETKMALNYQSKSQKRSAVEKSMNAFLIVYLCILISKALINTVLKYMWQSE------PFRDEPW 328
            |.|||..||......|||.||:.||..:|..:.||:...::..:...||.|.      |:...  
  Fly   474 GHETKSMLNNSGPRYKRSQVEQQMNIDVIWCVIILLILCVVGAIGCRMWLSSFTHFPVPYLPP-- 536

Human   329 YNQKTESERQRNLFLKAFTDFLAFMVLFNYIIPVSMYVTVEMQKFLGSYFITWDEDMFDEETGEG 393
             |:.|.:       :::...|..::|:...:||:|:|||:|:.|.|..:.|..:.|:||.||.:.
  Fly   537 -NKLTAN-------MESMWIFWTYIVILQVMIPLSLYVTIELCKILQVFHIHNNVDLFDAETNKQ 593

Human   394 PLVNTSDLNEELGQVEYIFTDKTGTLTENNMEFKECCIEGHVY---------------------- 436
            ......::.|||||:::||||||||||||.|.|:.|.:.|..|                      
  Fly   594 TECRAMNITEELGQIQHIFTDKTGTLTENKMIFRRCVVNGSDYNHPPSELEKIYSKPGAPAPPLI 658

Human   437 ------------------VPH-----------VICNGQV--------LPESSGI---DMIDSSPS 461
                              .||           .|||..:        :..:|||   ..|.:||:
  Fly   659 PNDNLNSDMAQLTQGTYLTPHAQRIQEFLVVLAICNTVIVGAAPHRDMMNASGIIEVQQIGNSPA 723

Human   462 --VNGREREELFFRALCLCHTVQV----------------------------------------- 483
              .:|::|::|...:.....|..:                                         
  Fly   724 NLKHGKQRQKLLASSTSTTTTTTIINGPTTQPQVVSIPADRYIRLAESRSVTPSPPPNLLFALPA 788

Human   484 -------------------KDDDSVDGPRK--------SPDGGKSCV------------------ 503
                               .:.:|...|.|        ||.|....|                  
  Fly   789 QSHQPTLSPISSSAESSPNSESESPSPPMKNKSLSNSISPTGRAKAVINSKITSIATFLNAKTQG 853

Human   504 ----------------------YISSSPDEVALVEGVQRLGFTYLRLKDNYMEI-LNRENHIERF 545
                                  |.:.||||:|||..........|....|.:.: :........:
  Fly   854 KRMKLPSSKTGTIYRTADGRPLYEAESPDELALVNAAYSYDCCLLNRSPNQILVSMPMAGATREY 918

Human   546 ELLEILSFDSVRRRMSVIVKS-ATGEIYLFCKGADSSIFPRVI-------EGKV-DQIRARVERN 601
            |:|::|.|||.|:.||::|:. .:.||.|:.|||||||.|.::       ||.: :|.:..::|.
  Fly   919 EILKVLPFDSSRKCMSIVVRQIGSQEIVLYTKGADSSIMPVLVPCSHNSPEGILREQTQQLLDRY 983

Human   602 AVEGLRTLCVAYKRLIQEEYEGICKLLQAAKVALQDREKKLAEAYEQIEKDLTLLGATAVEDRLQ 666
            |.||||.|.:|.:.|...:|.......|..:::|::||::|.:::.::|.:|||||||.:|||||
  Fly   984 AREGLRILVMAKRTLNSADYTDWWARHQEIEMSLENRERRLRDSFAKLESNLTLLGATGIEDRLQ 1048

Human   667 EKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIE--EQSLHDVLFE 729
            :...:||.:|..|||.||||||||.|||....|:.|||.:..:|:.||.:..:  |.:::..|.:
  Fly  1049 DGVPETIASLLSAGISVWVLTGDKPETAINIAYSAKLFTQQMELIRLTARSRDAAETAINFYLTD 1113

Human   730 LSKTVLRHSGSLTRDNLS-GLSADMQDYGLIIDGAALSLIMKPREDGSSGNYREL---FLEICRS 790
            :       ....|...|. |.|...:...|::||..|:.|:.|:.        :|   ||.:.:.
  Fly  1114 M-------ENDKTTSTLGYGQSLRKKQRALVVDGKTLTFILDPKS--------KLILPFLRLSKR 1163

Human   791 CSAVLCCRMAPLQKAQIVKLIKFSKEHPITLAIGDGANDVSMILEAHVGIGVIGKEGRQAARNSD 855
            |::|||||..|||||.:||::| .:.:..||||||||||||||..|.||:|:.|:||.||...:|
  Fly  1164 CASVLCCRSTPLQKAYLVKVVK-EELNLRTLAIGDGANDVSMIQMADVGVGISGQEGMQAVMAAD 1227

Human   856 YAIPKFKHLKKMLLVHGHFYYIRISELVQYFFYKNVCFIFPQFLYQFFCGFSQQTLYDTAYLTLY 920
            :.:|:|::|:::||.||::.|.|:|.::.||||||..|:|..|.||.:||||.|.:.|..||.||
  Fly  1228 FTLPRFRYLERLLLAHGYWCYDRLSRMILYFFYKNAAFVFLIFWYQLYCGFSGQVMMDQMYLMLY 1292

Human   921 NISFTSLPILLYSLMEQHVGIDVLKRDPTLYRDVAKNALL--RWRVFIYWTLL--GLFDALVFFF 981
            |:.|||||.|...:.::.|..|:|.::|.||    ||..|  .:|...:|.:|  .|:.:||.||
  Fly  1293 NLIFTSLPPLAIGVYDKRVAEDLLLKNPYLY----KNGRLGVAYRPHDFWLILLDALYQSLVIFF 1353

Human   982 GAYFVFENTTVTSNGQIFGNWTFGTLVFTVMVFTVTLKLALDTHYWTWINHFVIWGSLLFYVVFS 1046
            .|...:..:.|       |.|.|||.:....:|...:..|::...||.::...|..||..:.:|:
  Fly  1354 VALCAYAESDV-------GIWEFGTTITASCLFANLVHCAIEIRSWTVLHVLSIVLSLGSFYLFA 1411

Human  1047 LLWGGVIWPFLNYQRMYYVFIQMLSSGPAWLAIVLLVTISLLPDVLKKVLCRQLWP-TATERVQQ 1110
            :::..|.......:..|:|.....:|...||.|:|...:::||.:|...:...|.| .:|:.:.|
  Fly  1412 IVYDSVCMNCFGVRSSYWVIFVCFASAVHWLVIMLSTVVAVLPRLLLTTVRISLCPDDSTKVILQ 1476

Human  1111 NGCAQPRDRDSEFTPLASLQSPGYQSTCPSAAW----YSSHSQQVT 1152
            :    .|:|......|.:..    :||..|:.:    |.|.:|.:|
  Fly  1477 S----KRERSRGEALLVTWS----RSTSASSIYRITDYGSKNQIIT 1514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ATP11AXP_005268356.1 PhoLip_ATPase_N 42..95 CDD:292826 24/54 (44%)
ATPase-Plipid 45..1110 CDD:273734 388/1277 (30%)
E1-E2_ATPase 102..>187 CDD:278548 32/87 (37%)
Cation_ATPase 477..585 CDD:289987 39/218 (18%)
R3H 639..695 CDD:294210 32/56 (57%)
HAD_like <806..849 CDD:304363 24/43 (56%)
PhoLip_ATPase_C 851..1103 CDD:292829 84/257 (33%)
CG33298NP_995666.1 PhoLip_ATPase_N 249..299 CDD:292826 24/56 (43%)
ATPase-Plipid 250..1473 CDD:273734 388/1274 (30%)
E1-E2_ATPase 302..>394 CDD:278548 32/92 (35%)
Cation_ATPase <880..965 CDD:289987 30/85 (35%)
HAD_like <1177..1240 CDD:304363 32/64 (50%)
PhoLip_ATPase_C 1223..1468 CDD:292829 84/256 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0474
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D587717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.