DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LARP4B and larp

Sequence 1:XP_016871476.1 Gene:LARP4B HGNCID:28987 Length:1273 Species:Homo sapiens
Sequence 2:NP_001247347.1 Gene:larp FlyBaseID:FBgn0261618 Length:1673 Species:Drosophila melanogaster

Alignment Length:1284 Identity:242/1285 (19%)
Similarity:383/1285 (30%) Gaps:435/1285 (34%)


Human     7 RELSSDNDSEKTGLLQKSVEEKEPENKISKTLSSLFDTVKGEEVHRTGSGASSVAGVSARTRIFA 71
            |.:...:|:|:     |||..:.|               :|....::.:||:..||.:|.....|
  Fly   160 RRVPGSSDTER-----KSVRPRAP---------------RGGSPRKSAAGAAGAAGSNAGAVSSA 204

Human    72 GSGHKQGHRPKQSLNPLSSFIYTFSTRYENLGENDKNSDIVVNEQNSEGVCDLLCVGNGSRQGCW 136
            ..|..:.|:.::..:|.:|.        |..|.:...:.....:|.:         |.....|..
  Fly   205 VPGGPKVHKDRKDTSPSASI--------EGAGSSGNEAKSADGDQQA---------GEKGAAGAA 252

Human   137 EDEELFSCVLVPSDRGLQEEAFVSGHLHCYPATCKNSLVEKEMVVSVHLSSGDESKSLDLSDRER 201
            ...:.|.....|.....:..|..||.    |....:.|.::.:............::...::..:
  Fly   253 PPPKRFIAAPPPKVNAWKISAKQSGS----PKAGTSPLDKRVLQPKAQQQQQQTKQTASQNNNAQ 313

Human   202 KDGNPVGIDDQQCQDSGECKFHSICVADSACPSVAEELGTWVDTVAARGECCSSVPSASRAMSGA 266
            ...:......||....|.........|.:|..:.|........:.||.....::||:|:...:..
  Fly   314 NTASNKKTQQQQQPQQGATTTTQTTTAAAAAATAAAAATAATTSAAAATSSAAAVPAATTETATT 378

Human   267 GEPEPRQEE----------------------LSPWDTLGPGERTGECSGKAKPCPEPVAFSHAPC 309
            ...:..|.:                      :..|.||     .|..||..|      |.|:.| 
  Fly   379 TTVDASQADALAKVVVKDKKKVNQKASDFSNVGDWPTL-----IGGTSGSGK------ATSNEP- 431

Human   310 EANTDNVQMEALQAEACTEFPKNYAESSALHGIDLLPELNNNMDSDSLSHACVLGESESCNSGVG 374
            :.|....|..|..|.|       .|.||            |...|:..:.:.|.|.:.|.||   
  Fly   432 KRNPTKKQQSAKTAAA-------VAASS------------NTTSSEVATESNVAGTTSSSNS--- 474

Human   375 SEMDHPPGGFRTDTAHSPGSFCTDTACVAGSDDPEVVTVVVDQSLHSKKERENNSITPLRDNDDF 439
                            :|.|..|.|.....|   :..|..|..:.|..|.:.             
  Fly   475 ----------------NPSSSTTTTNTTTNS---QATTAPVASTSHDAKAQR------------- 507

Human   440 YLDVNKADSILPVGLDRIDLSPKRPITAVRFGSGCLSGHANSREAAPSQLDDCWEPEPV------ 498
                              |..|.....|..  :|..:|.|.:::....:    |.|.|:      
  Fly   508 ------------------DAEPAANSAAGT--TGTAAGPALTKKIPKHK----WRPLPIDLAKSS 548

Human   499 -PRQV--RKAQRRGDCSLEARSP--LLPDRENTPQLPVSEDGVVWGWHDRDGQFV----PATKVS 554
             |:.:  |..:|..|...:.|.|  :..||:     |.:....|...|...|:..    |||..|
  Fly   549 RPKPIGGRPNRRFSDDIADQRRPPRVYHDRQ-----PGAGGAGVESRHPHAGRHPYGSRPATATS 608

Human   555 ELNPNAEVWGA------PVLHLEASSAADGVSAAWEEVAGHHADRGP-----------QGSDANG 602
            |   ..:.|.:      .....:.|.||.|..||...|..  |.|||           ||.....
  Fly   609 E---RVDSWRSSSSTTTAAFDEQRSGAAGGAGAAGTGVGS--ATRGPRRYRTPYRGGRQGRGGFS 668

Human   603 DGDQGHENAALPD------------PQESDPADMNA--LALG-------PSEYDSLPENSETGGN 646
            ....|.....:|.            |.::..||..:  :.:|       |:.|..|..||     
  Fly   669 RQGPGRPTYRIPRHLLASGEYANYLPADAAGADSQSSYVLMGTHYFGNVPAAYIELDANS----- 728

Human   647 ESQPDSQEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQYVPITTVANLDHIKKLSTDVDLIV 711
                     .:|.:||.:|:..|.:||..|.:|..:||.:.|:|:|.:|:...:..|:|||.:||
  Fly   729 ---------IKEAIKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIV 784

Human   712 EVLRSLPLVQVDEKGEKVRPNQNRCIVILREISESTPVEEVEALFKGDNLPKFINCEFAYNDNWF 776
            ..::....:::.| |.|||         .:....:.|:.||..:.:|:  ||.|.          
  Fly   785 NAIKESDKLELFE-GYKVR---------TKTTPTTWPITEVPEVNEGE--PKAIG---------- 827

Human   777 ITFETEA----DAQQAYKYLREEVKTFQGKPIKARIKAKAIAINTFLPKNGFRPLDVSLYAQQRY 837
             |.|.|.    |.|:.   |.|:.:.....||.....|..       |.|...|           
  Fly   828 -TLEQEQLEQNDGQEK---LEEQTEADSPPPILTSAMATK-------PLNSIPP----------- 870

Human   838 ATSFYFPPM-YSPQQQFPLYSLITPQTWSATHSYLDPPLVTPFPNTGFINGFTSPAFKPAASPLT 901
                  ||| .:||...|.......|:.|:|.:.|:                       :.:.::
  Fly   871 ------PPMPRNPQNLVPKMLQDKQQSRSSTIAALN-----------------------SVNAIS 906

Human   902 SLRQYPPRSRNPSKSHLRHAIPSAERGPGLLES--PSIFNFTADRLINGVRSPQTRQAGQTRTRI 964
            :|.|...........||          .||.||  |           ....:|..|.|.      
  Fly   907 ALTQQVEGGAAELAGHL----------SGLAESVKP-----------KSTSTPDKRNAA------ 944

Human   965 QNPSAYAKREAGPGRVEPGSLESSP-GLGRGRKNSFGYRKKREEKFTSSQTQSPTPPKPPSPSFE 1028
                     .||.|.....:|.:.| |:.:        ..||..|..:.:..:.|||:...|...
  Fly   945 ---------SAGNGAGSAAALVAEPEGIWK--------EVKRRSKTNAIKENATTPPQQQQPPLS 992

Human  1029 LGLSSFPPLPGAAGNLKTEDLFENRLSSLIIGPSKERTLSADASVNTLPVVVSREPSVPASCAVS 1093
            ..|::      ...|:||.:......||....||   ..|:.|:|           .|..:.|.|
  Fly   993 QTLNN------NNDNVKTNNTSSKSKSSSNNAPS---NASSSATV-----------CVTTNNASS 1037

Human  1094 ATYERSPSPAHLPDDPKVAEKQRETHSVDRLPSALTATACKSVQVNGAATVRTSCLPSCTTAARL 1158
            ||              |...|...|       |..|.|...:::...||..:|....|..|||  
  Fly  1038 AT--------------KATTKTTTT-------STATTTTNNNIKSGNAAYSKTHSKSSSKTAA-- 1079

Human  1159 WCEQTLRTPAPARFLITSNLELRKPSYAEICQRTSKEPPSSPLQPQKEQ 1207
                                                 |||:....:||:
  Fly  1080 -------------------------------------PPSAQCHAEKEE 1091

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LARP4BXP_016871476.1 None
larpNP_001247347.1 LARP_1_2 730..803 CDD:153403 26/83 (31%)
DM15 1341..1382 CDD:128927
DM15 1383..1421 CDD:128927
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121327463
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.