DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: LARP4B and Larp4B

Sequence 1:XP_016871476.1 Gene:LARP4B HGNCID:28987 Length:1273 Species:Homo sapiens
Sequence 2:NP_647793.1 Gene:Larp4B FlyBaseID:FBgn0035424 Length:1531 Species:Drosophila melanogaster

Alignment Length:795 Identity:216/796 (27%)
Similarity:321/796 (40%) Gaps:214/796 (27%)


Human   541 HDRDGQFVPATKVSELNPNAEVWGAPVLHLEASSAADGVSAAWEEVAGH-----HADRGPQGSDA 600
            |....|.:..|.|:......:.......||...........|.....||     .|..|..|:.:
  Fly   103 HPHQAQILAHTHVAHQQQQQQQQQTIQQHLHQQQQQQSPHPAQHLTYGHQPALSQATAGGSGTIS 167

Human   601 NG---------DGDQGHE----NAALPDPQESDPA--------DMNALALGPSEYD--------- 635
            .|         :|...:|    |.||...|:....        :.|.:||.|..:.         
  Fly   168 GGAVGPSGVVVEGQDTNEYAIMNGALGQTQDGTVVCYTTDALNNTNLVALDPQPHQIVVPVQVPV 232

Human   636 ------SLPENSETGGNESQPDSQ-----EDP-------REVLKKTLEFCLSRENLASDMYLISQ 682
                  .||.|   |..:.|..|.     |:|       :::|...||:..||||||:|.||:||
  Fly   233 QVPVPVQLPAN---GSADPQQGSHNAAGGEEPNIPLDKLKQMLATQLEYYFSRENLANDTYLLSQ 294

Human   683 MDSDQYVPITTVANLDHIKKLSTDVDLIVEVLRSLPLVQVDEKGEKVRPNQNRCIVILREISEST 747
            |||||||||.|||..:.::||:.|::||.||||..|.||||:||.:||||:.|||:||||||.:|
  Fly   295 MDSDQYVPIYTVARFNLVRKLTNDINLITEVLRESPNVQVDDKGLRVRPNRKRCIIILREISNNT 359

Human   748 PVEEVEALFKGDNLPKFINCEFAYNDNWFITFETEADAQQAYKYLREEVKTFQGKPIKARIKAKA 812
            |:::|:|||..::.|:.|:||||.|::|:||||::.|||:||||||||||.||||||.||||.|:
  Fly   360 PLDDVKALFSNESCPRPISCEFAANNSWYITFESDEDAQKAYKYLREEVKEFQGKPIMARIKPKS 424

Human   813 IAINTF--LPKNGFR---PLDVSLYAQQRYATSFYFPP--------MYSPQQQFPLY------SL 858
            . ||..  :||||:|   |           .|:..|.|        .|:..|| |.|      ::
  Fly   425 F-INRIQAVPKNGYRLTSP-----------PTANVFDPAGAGGATVSYAAAQQ-PRYLYTNGAAI 476

Human   859 ITPQTWSATHSYLDPPLVTPFPNTGFINGFTSPAFKPAASPLTSLRQYPPRSRNPSKSH------ 917
            ..|    |:..|.:|.|: |.|...|..|.       .|.|      :||.:...:.:|      
  Fly   477 AAP----ASVQYSNPVLI-PIPQNQFYPGL-------VAGP------WPPGTVAATTAHGQNFYE 523

Human   918 ------LRHAIPSAERGPGLLESPSIFNFTADRLINGVRSPQTRQAGQTRTRIQNPSAYAKREAG 976
                  ..:.:|......|..::|                |.|.||..| .:.|....|.....|
  Fly   524 LGGNIFTTNPLPPQPVTAGFAQAP----------------PPTSQAMVT-PKPQGGGRYNNNHRG 571

Human   977 -PGRVEPGSLESSPGLGRGRKNSFGYRKKREEKFTSSQTQSPTPPKPPSPSFELGLSSFP----- 1035
             |..|  |...|.|                     .::::|..|...||.|...|.:..|     
  Fly   572 NPNNV--GGANSGP---------------------RAESRSKPPRSTPSASHIQGGNIMPIQITA 613

Human  1036 PLPGAAGNLKTEDLFENRLSSLIIGPSKERTLSADASVNTLPVVVSREPSVPASCAVSATYERSP 1100
            |:||...::...::.::.|....:....::.:..          :.::||..|....:||.:.:.
  Fly   614 PIPGGMVSVVPTNIVQDPLQPAPLQQQPQQVIQQ----------IQQQPSSSAQQQQAATVQMNN 668

Human  1101 SPAHLPDDPK----------------VAEKQRETHSVDRLPSALTATACKSVQVNGAATVRTSCL 1149
            :..|.|....                ||.....|..|..||:.......:. |:.|....:...|
  Fly   669 TTRHYPIKSNWKGGMQKNLDKSYSGGVATHHHYTTQVQALPAHSHHLQAQQ-QLQGQTQQQHYQL 732

Human  1150 PSCTTAARLWCEQTLRTPAPARFLITSNLELRKPSYAE---ICQRTSKEPPSSPLQPQKEQKPNT 1211
            .|.:.|:..........|||           ::|...:   :.|:|         |||::|:...
  Fly   733 ASSSAASAPQVTYVTTAPAP-----------QQPGQHQHHLVVQQT---------QPQQQQQQQQ 777

Human  1212 VGCGKEEKKLAEPAE 1226
            |...:::.::.|..|
  Fly   778 VVLQQQQVQVQELQE 792

Known Domains:


GeneSequenceDomainRegion External IDIdentity
LARP4BXP_016871476.1 None
Larp4BNP_647793.1 LARP_4_5_like 269..343 CDD:153400 44/74 (59%)
RRM_LARP4_5_like 348..423 CDD:240876 49/75 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C121036415
eggNOG 1 0.900 E1_KOG2591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001708
OrthoInspector 1 1.000 T609500
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR22792
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3384
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.