DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: MESD and boca

Sequence 1:NP_055969.1 Gene:MESD HGNCID:13520 Length:234 Species:Homo sapiens
Sequence 2:NP_724578.1 Gene:boca FlyBaseID:FBgn0004132 Length:180 Species:Drosophila melanogaster

Alignment Length:175 Identity:83/176 (47%)
Similarity:121/176 (69%) Gaps:8/176 (5%)


Human    19 LLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDD-IEEGDLP 82
            |:||||.|.|    .........:|.   |...|||||||::||:.|||:|||:|:: :|:.:||
  Fly     5 LVLLLLALTP----LVLAKKFKEEEK---PAWAKKDIRDYSEADLERLLDQWEEDEEPLEDDELP 62

Human    83 EHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDV 147
            ||.||...:|.|.:|...||.:||::|||:|||.||:|:|:||.:|::.||.|||.||:|.:...
  Fly    63 EHLRPQPKLDLSNLDSKSPEDLLKVSKKGRTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQA 127

Human   148 QRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPG 192
            :|::|..:||||:.:||:.||:.||||:.|:||..||:|.:.|||
  Fly   128 ERYMVDDNRAIFLFKDGTQAWDAKDFLIEQERCKGVTIENKEYPG 172

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MESDNP_055969.1 Chaperone domain. {ECO:0000250|UniProtKB:Q9ERE7} 1..164 67/146 (46%)
Mesd 52..201 CDD:313423 74/143 (52%)
Escort domain. {ECO:0000250|UniProtKB:Q9ERE7} 165..204 15/29 (52%)
Prevents secretion from ER 231..234
bocaNP_724578.1 Mesd 31..178 CDD:287194 74/143 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C256676228
eggNOG 1 0.900 E1_KOG4357
Hieranoid 1 1.000
Homologene 1 1.000 H11347
Inparanoid 1 1.050 170 1.000 Inparanoid score I4063
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1590303at2759
OrthoFinder 1 1.000 FOG0004891
OrthoInspector 1 1.000 T1073406
orthoMCL 1 0.900 OOG5_133284
Panther 1 1.100 LDO PTHR17600
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4085
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.