DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SLC35D1 and frc

Sequence 1:XP_006710541.1 Gene:SLC35D1 HGNCID:20800 Length:382 Species:Homo sapiens
Sequence 2:NP_001137962.1 Gene:frc FlyBaseID:FBgn0042641 Length:373 Species:Drosophila melanogaster

Alignment Length:377 Identity:184/378 (49%)
Similarity:252/378 (67%) Gaps:36/378 (10%)


Human     2 AEVHRRQHARVKGEAPAKSSTL--RDEEELGMASAETLTVFLKLL-AAGFYGVSSFLIVVVNKSV 63
            ::|..|:.....|.:..:||.|  ...:||.....|...:|:|.: :|.|||:|||:|.||||:|
  Fly    20 SDVGNRELEEKMGGSADRSSLLDGSGSKELSHREREDSALFVKKIGSALFYGLSSFMITVVNKTV 84

Human    64 LTNYRFPSSLCVGLGQMVATVAVLWVGKALRVVKFPDLDRNVPRKTFPLPLLYFGNQITGLFSTK 128
            ||:|.|||.|.:.|||:.|::.||.:||.|::|.||.|.||...|.|||||::.||.:.||..||
  Fly    85 LTSYHFPSFLFLSLGQLTASIVVLGMGKRLKLVNFPPLQRNTFAKIFPLPLIFLGNMMFGLGGTK 149

Human   129 KLNLPMFTVLRRFSILFTMFAEGVLLKKTFSWGIKMTVFAMIIGAFVAASSDLAFDLEGYAFILI 193
            .|:||||..|||||||.||..|..:|....|..::::|:|||.||.:|||.||:|::.||.:::|
  Fly   150 TLSLPMFAALRRFSILMTMLLELKILGLRPSNAVQVSVYAMIGGALLAASDDLSFNMRGYIYVMI 214

Human   194 NDVLTAANGAYVKQKLDSKELGKYGLLYYNALFMILPTLAIAYFTGDAQKLPVSQDRRFQALWQR 258
            .:.|||:||.|||:|||:.|:|||||:|||:|||.||.||:.|.||:.                 
  Fly   215 TNALTASNGVYVKKKLDTSEIGKYGLMYYNSLFMFLPALALNYVTGNL----------------- 262

Human   259 ACLVLCHTQNDQAVEFEGWADTLFLLQFTLSCVMGFILMYATVLCTQYNSALTTTIVGCIKNILI 323
                      |||:.||.|.|::|::||.|||||||||.|:|:||||:|||||||||||:|||.:
  Fly   263 ----------DQALNFEQWNDSVFVVQFLLSCVMGFILSYSTILCTQFNSALTTTIVGCLKNICV 317

Human   324 TYIGMVFGGDYIFTWTNFIGLNISIAGSLVYSYITFTEEQLSKQSEANNKLD 375
            ||:||..||||:|:|.|.||:|||:..||:|:|:||      ::..|.:|.|
  Fly   318 TYLGMFIGGDYVFSWLNCIGINISVLASLLYTYVTF------RRKRAPDKQD 363

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SLC35D1XP_006710541.1 VRG4 49..356 CDD:227402 165/307 (54%)
frcNP_001137962.1 TPT 67..348 CDD:281186 166/308 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5070
Hieranoid 1 1.000
Homologene 1 1.000 H22870
Inparanoid 1 1.050 361 1.000 Inparanoid score I2164
Isobase 1 0.950 0 Normalized mean entropy S1931
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001743
OrthoInspector 1 1.000 T609477
orthoMCL 1 0.900 OOG5_127495
Panther 1 1.100 LDO PTHR11132
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R503
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.810

Return to query results.
Submit another query.