DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: FLI1 and Ets96B

Sequence 1:NP_002008.2 Gene:FLI1 HGNCID:3749 Length:452 Species:Homo sapiens
Sequence 2:NP_996290.1 Gene:Ets96B FlyBaseID:FBgn0039225 Length:640 Species:Drosophila melanogaster

Alignment Length:270 Identity:83/271 (31%)
Similarity:125/271 (46%) Gaps:59/271 (22%)


Human   157 SFFQNMDGKELCKMNKEDFLRATTLYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLSVKEDPS 221
            |.::::....|..::..|....:..||..:..::.|.||.:   ..::|:.:|...||    |..
  Fly   419 SVYRDLSPTTLAAVSDADLKYDSGPYNAAISSTYPSALRPN---VVDSTTSSDAELRL----DQF 476

Human   222 YDSVRRGAWGNNMNSGLNKSPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQF 286
            |.|           :|::.|   ...|.||:.                        .|.:|||||
  Fly   477 YAS-----------NGISTS---SNGQAISQR------------------------RGSLQLWQF 503

Human   287 LLELLSD-SANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTK 350
            |:.||.: :.:||||.|.|...|||:.:|:|||||||.:|::|.||||||||:|||||:|.||.|
  Fly   504 LVALLDEPTTSASCIAWTGRGMEFKLIEPEEVARRWGLQKNRPAMNYDKLSRSLRYYYEKGIMQK 568

Human   351 VHGKRYAYKF--DFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSS 413
            |:|:||.|:|  |...:......|.|..|           .....||..::.....|:|....:.
  Fly   569 VNGERYVYRFVCDPDALFNMAYGHLTTGS-----------GKGDQHQLTLSLAKTPPTSGDSQTQ 622

Human   414 SFFGAASQYW 423
            |...|.|:|:
  Fly   623 SPRVAKSEYY 632

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FLI1NP_002008.2 SAM_PNT-FLI-1 114..204 CDD:188883 8/47 (17%)
ETS 280..363 CDD:197710 51/86 (59%)
Ets96BNP_996290.1 ETS 497..583 CDD:197710 51/86 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3806
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.