DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: HIC2 and CG31365

Sequence 1:NP_055909.2 Gene:HIC2 HGNCID:18595 Length:615 Species:Homo sapiens
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:429 Identity:92/430 (21%)
Similarity:144/430 (33%) Gaps:135/430 (31%)


Human   264 HLTPDDAAQLSDSQHGSPPAASAPPVANSASYSELGGTPDEPMDLEGAEDNHLSLLEAPGGQPRK 328
            :||...|.:. :|..||.| .:.|.|...||.|.        ...:.......||::|       
  Fly   217 YLTEKKAGRW-ESLDGSEP-ETKPQVKEDASPSR--------SKTKALPKRRPSLVDA------- 264

Human   329 SLRHSTRKKEWGKKEPVAG---SPFERREAGPKG-----PCPGEEGEG------VG--------- 370
            :|:.:..:|:..::|.:.|   .|....:....|     ..|.|.||.      ||         
  Fly   265 NLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDVVHTDNG 329

Human   371 ---------------DRVP-----NGILASGAGPSGPY---GEPPYPCK---------------- 396
                           |..|     |||.:......|..   ||.|...:                
  Fly   330 EIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEEISQEQQ 394

Human   397 -----------EEEENGKDASEDSAQSGSEGGSGHASAHYMYRQEGY----ETVSYGDNL--YVC 444
                       |:|:|.:|......:.        .|:..:::||..    :|....|.:  :.|
  Fly   395 VFSFHENVIIVEKEQNDRDEQTPLKRK--------RSSELVFKQESSCPQPKTGRITDTVKSFQC 451

Human   445 IPCAKGFPSSEQLNAHVETHTEEELFIKEEGAYETGSGGAEEEAEDLSAPSAAYTAEPRPFKCSV 509
            ..|...||:.:.|..|..||.:         ..::|.||.                    .||..
  Fly   452 HLCPVAFPTQKLLTRHHNTHIK---------GLKSGKGGT--------------------LKCPS 487

Human   510 CEKTYKDPATLRQHEKTHWLTRPFPCNICGKMFTQRGTMTRHMRSHLGLKPFACDECGMRFTRQY 574
            |.......::|::|...|...:||.|:.|...|:||..:.|||.:|.|:|...|.:|...|.::.
  Fly   488 CALQLSCASSLKRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKS 552

Human   575 RLTEHM-RVHSG-EKPYECQLCGGKFTQQRNLISHLRMH 611
            .|.:|: |||.| .:.::|.||...|.....|..||..|
  Fly   553 NLQQHIGRVHMGNSRTHKCHLCHRSFNHVSGLSRHLVTH 591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HIC2NP_055909.2 BTB 40..140 CDD:279045
BTB 47..141 CDD:197585
Binding to CtBP 246..250
TMEM119 <300..395 CDD:292352 24/141 (17%)
C2H2 Zn finger 444..464 CDD:275368 7/20 (35%)
zf-C2H2 505..527 CDD:278523 5/22 (23%)
C2H2 Zn finger 507..527 CDD:275368 4/20 (20%)
zf-C2H2 533..555 CDD:278523 9/22 (41%)
C2H2 Zn finger 535..555 CDD:275368 8/20 (40%)
zf-H2C2_2 548..572 CDD:290200 9/24 (38%)
COG5048 559..>613 CDD:227381 18/56 (32%)
C2H2 Zn finger 563..583 CDD:275368 7/21 (33%)
zf-H2C2_2 576..600 CDD:290200 10/26 (38%)
C2H2 Zn finger 591..611 CDD:275368 7/20 (35%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 9/29 (31%)
RRF <161..222 CDD:294170 2/5 (40%)
zf-C2H2_8 454..530 CDD:292531 25/105 (24%)
C2H2 Zn finger 485..505 CDD:275368 4/20 (20%)
zf-H2C2_2 497..522 CDD:290200 8/25 (32%)
C2H2 Zn finger 513..533 CDD:275368 8/20 (40%)
zf-H2C2_2 526..550 CDD:290200 9/24 (38%)
C2H2 Zn finger 541..562 CDD:275368 7/21 (33%)
C2H2 Zn finger 571..591 CDD:275368 7/20 (35%)
C2H2 Zn finger 598..617 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.