DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ZBTB43 and CG31365

Sequence 1:NP_001129248.1 Gene:ZBTB43 HGNCID:17908 Length:467 Species:Homo sapiens
Sequence 2:NP_732827.1 Gene:CG31365 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster

Alignment Length:385 Identity:83/386 (22%)
Similarity:133/386 (34%) Gaps:114/386 (30%)


Human   168 AQELR-----DGENE--EESTKDELSSQLTEHE-YLPSNSSTEHDRL------STEMASQDGEEG 218
            |:|:|     |..||  |:..|::|:..|.|.| ||....:...:.|      :.....:|....
  Fly   183 AEEVRSQVRDDLRNEVSEDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPS 247

Human   219 ASDSAEFHYTRPMYSKPSIMAHKRWIHVKPERLEQAC------------EGMDVHATYDEHQVTE 271
            .|.:......||.....::.|.:.....|.|.....|            :|:::    ||....|
  Fly   248 RSKTKALPKRRPSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLEL----DEEVPAE 308

Human   272 S------INTVQTEHTVQPSGVEEDFHIGEKKVEAEFDEQADESNYDEQVDFYGSSME---EFSG 327
            |      ||.|.::.....:|  |.:.|.....|.:..:...|.:.|..:..|....:   :|||
  Fly   309 SGEDFREINMVGSDVVHTDNG--EIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSG 371

Human   328 ERSD----------GNLIGHRQEAALAAGYSENIEMV----------TGIK-EEASHLGFS---- 367
            |:.:          |..|...|:   ...:.||:.:|          |.:| :.:|.|.|.    
  Fly   372 EKPEEIEDVVVFNLGEEISQEQQ---VFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESS 433

Human   368 --------ATDKLYPCQC--------------------------GKSFTHK-----------SQR 387
                    .||.:...||                          ||..|.|           |..
  Fly   434 CPQPKTGRITDTVKSFQCHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSL 498

Human   388 DRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIHTGIKPYECNICAKRFMWRDSFHRHV 447
            .|||.:|.||:|:.|..|...|..:..|..||..|||:|.::|..|:..|..:.:..:|:
  Fly   499 KRHMIIHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHI 558

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ZBTB43NP_001129248.1 BTB 23..123 CDD:306997
C2H2 Zn finger 376..394 CDD:275368 10/55 (18%)
C2H2 Zn finger 402..422 CDD:275368 6/20 (30%)
zf-H2C2_2 414..437 CDD:316026 9/23 (39%)
C2H2 Zn finger 430..447 CDD:275368 4/17 (24%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 16/61 (26%)
RRF <161..222 CDD:294170 14/39 (36%)
zf-C2H2_8 454..530 CDD:292531 17/76 (22%)
C2H2 Zn finger 485..505 CDD:275368 4/20 (20%)
zf-H2C2_2 497..522 CDD:290200 10/25 (40%)
C2H2 Zn finger 513..533 CDD:275368 6/20 (30%)
zf-H2C2_2 526..550 CDD:290200 10/24 (42%)
C2H2 Zn finger 541..562 CDD:275368 4/19 (21%)
C2H2 Zn finger 571..591 CDD:275368
C2H2 Zn finger 598..617 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.