DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FOXO3 and foxo

DIOPT Version :8

Sequence 1:NP_001446.1 Gene:FOXO3 / 2309 HGNCID:3821 Length:673 Species:Homo sapiens
Sequence 2:NP_001262557.1 Gene:foxo / 41709 FlyBaseID:FBgn0038197 Length:622 Species:Drosophila melanogaster

Alignment Length:701 Identity:230/702 (33%)
Similarity:286/702 (41%) Gaps:236/702 (34%)


Human    15 EVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGSAMAI 79
            ::.||..||||:|.||.|||..|||....|......|.|                          
  Fly    27 DLPLDVGFEPQTRARSNTWPCPRPENFVEPTDELDSTKA-------------------------- 65

Human    80 GGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGS 144
                             |.:.||||........|.||                            
  Fly    66 -----------------SNQQLAPGDSQQAIQNANAA---------------------------- 85

Human   145 GQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNS 209
               :|.|||||||||||||||||.||.|:.||||||||||||||:.|||||||||||||||||||
  Fly    86 ---KKNSSRRNAWGNLSYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDKGDSNSSAGWKNS 147

Human   210 IRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAAL 274
            ||||||||:||||||||||||||||::||: .|.||:.||||.||:.| :|.|.||||.|:..||
  Fly   148 IRHNLSLHNRFMRVQNEGTGKSSWWMLNPE-AKPGKSVRRRAASMETS-RYEKRRGRAKKRVEAL 210

Human   275 QTAP----ESADDSPSQ-----LSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMAS 330
            :.|.    ..|..|||.     |..:|.||. .|........|||.|.:||||: .||||||.| 
  Fly   211 RQAGVVGLNDATPSPSSSVSEGLDHFPESPL-HSGGGFQLSPDFRQRASSNASS-CGRLSPIRA- 272

Human   331 TELDEVQDDDAPLSPMLYSSSASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNIT 395
                  ||               |.|....|...:...:| .|....|     |.|...:.|.:|
  Fly   273 ------QD---------------LEPDWGFPVDYQNTTMT-QAHAQAL-----EELTGTMADELT 310

Human   396 L-------------PPSQPSP--------TGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSS 439
            |             .||||.|        .....|:....||...|     |.|.:|:  ..|.|
  Fly   311 LCNQQQQGFSAASGLPSQPPPPPYQPPQHQQAQQQQQQQSPYALNG-----PASGYNT--LQPQS 368

Human   440 LNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSDPLMSQASTAVSAQN 504
            ...|.:|...:...|                    ..|.||.:.|..|.|.          :..|
  Fly   369 QCLLHRSLNCSCMHN--------------------ARDGLSPNSVTTTMSP----------AYPN 403

Human   505 SRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNM---GLSESSSLG 566
            |                :|:..||                       |:.||:   |.:::::|.
  Fly   404 S----------------EPSSDSL-----------------------NTYSNVVLDGPADTAALM 429

Human   567 SAKHQQQSPVSQSMQTLSDSLSGSSLYSTSAN--LPVMGHEKFPSDLDLDMFN------GSLECD 623
            ..:.|||    |..|.||.||..::..||...  |.|:.:|..|    :|.||      |:|||:
  Fly   430 VQQQQQQ----QQQQQLSASLEDNNCASTLIGQCLEVLNNEAQP----IDEFNLENFPVGNLECN 486

Human   624 MESIIRSELMDADGLDFNFDSLISTQNVVG-----LNVGNFTGAKQASSQS 669
            :|.:::.|:.....||.|........|:|.     |::.|.:.....||.|
  Fly   487 VEELLQQEMSYGGLLDINIPLATVNTNLVNSSSGPLSISNISNLSNISSNS 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
FOXO3NP_001446.1 Required for mitochondrial import. {ECO:0000269|PubMed:23283301} 80..108 5/28 (18%)
FH 157..237 CDD:238016 71/80 (89%)
Nuclear localization signal. {ECO:0000269|PubMed:17940099, ECO:0000269|PubMed:29445193} 242..259 10/17 (59%)
Mediates interaction with CHUK/IKKA and IKBKB/IKKB. {ECO:0000269|PubMed:15084260} 300..673 95/408 (23%)
FOXO_KIX_bdg 433..508 CDD:318810 13/75 (17%)
FOXO-TAD 606..644 CDD:318811 13/44 (30%)
foxoNP_001262557.1 FH 95..175 CDD:238016 71/80 (89%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BC6N
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 263 1.000 Inparanoid score I3036
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000606
OrthoInspector 1 1.000 T609481
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45767
Phylome 1 0.910 0.900 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4575
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.950

Return to query results.
Submit another query.