DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PDZD2 and CG15803

Sequence 1:XP_005248326.1 Gene:PDZD2 HGNCID:18486 Length:2873 Species:Homo sapiens
Sequence 2:NP_001287388.1 Gene:CG15803 FlyBaseID:FBgn0038606 Length:880 Species:Drosophila melanogaster

Alignment Length:1029 Identity:217/1030 (21%)
Similarity:364/1030 (35%) Gaps:278/1030 (27%)


Human   328 EVGRIWKMELLKESDGLGIQVSGGRGSKRSPHAIVVTQVKEGGAAHRDGRLSLGDELLVINGHLL 392
            |..::..::|:.:.:|||..:.|||.:     .:|:..:..||.|.|||||.|||.||.|....|
  Fly     6 EWSQVEVIDLINDGNGLGFILVGGRST-----GVVIKALTPGGVAERDGRLQLGDHLLQIGEVNL 65

Human   393 VGLSHEEAVAILRSATGMVQLVVASK-ENSAEDLLRLTSKS--LP-DLTSSVEDVSSWTDNEDQE 453
            .|.|.|:...:||.....|:|:||.. |.:|.|...|..::  :| .|.|..|::|.........
  Fly    66 RGFSSEQVATVLRQTGAQVRLIVARPVEPTAIDYQTLACQAPIIPTKLLSDPEELSRHLFQNPSF 130

Human   454 ADGEEDEGTSSSVQRAMPGTDEPQDVCGAEESKGNLE----------SPKQGSNKIKLKSRLSGG 508
            |....   .:::...|..|:....||.|.    |.|:          .|.:|:....::.:.|..
  Fly   131 ATAAV---AAAAAAAAAAGSGSDGDVGGG----GVLDVASLVGLVRGGPAEGTELSAVEPQPSAA 188

Human   509 VHRLESVEEYNELMVRNGDPRIRMLEVSRDGRKHSLPQLLDSSSASQE-----------YHIVKK 562
            |.:|:.:.|.      .||.....|.....|..||   ::..|:|.|.           :.|:..
  Fly   189 VLQLQQLSEL------AGDLADFPLPPIPGGGGHS---MVTDSNAGQRPCPRLDLDIVPFSILSP 244

Human   563 STR-SLSTTQVESPWRLIR------PSVIS----------------------------------- 585
            ..| :|....:|:.||.::      .:||:                                   
  Fly   245 PPRPALQMLPLETQWRCVQDQNRHIETVIADSKRKLLANEDGGSASASGSGSPDSYMDSPETETY 309

Human   586 IIGLYKEKGKGLGFSIAGGRDCIRGQM-GIFVKTIFPNGSAAE-DGRLKEGDEILDVNGIPIKGL 648
            ::.|:|.. .|||.::| |..|....: |||||:|. .||||| .|:::..|.|:.|:|..:.|:
  Fly   310 VVELHKNV-YGLGITVA-GYVCEEEDLSGIFVKSII-EGSAAETSGQIQINDRIVAVDGRSLSGV 371

Human   649 TFQEAIHTFKQIRSGLFV-LTVRTKL-------VSPSLTP---CSTPTHMSRSASPNFNTSGGAS 702
            |..:|:...:  .:.:.| ||:...|       :..:||.   .|.|:.:.||..          
  Fly   372 TNHQAVELLR--NTDIVVHLTLERFLRGRKYEHLQVALTEIKGTSAPSGLDRSQD---------- 424

Human   703 AGGSDEGSSSSLGRKTPGPKDRIVMEVTLNKEPRVGLGIGACCLALENSPPGIYIHSLAPGSVAK 767
               .|:...|.|  ..||                               .|.|...|..|.....
  Fly   425 ---KDQDQESQL--SMPG-------------------------------SPSIATLSWLPPKSLD 453

Human   768 MESNLSRGDQILEVNSVNVRHAALSKVHAILSKCPPGPVRLVIGRHPNPKVSEQEMDEVIARSTY 832
            .:|..:.||:.::...|.:..|....:..                 |:....|..|..|:.||.:
  Fly   454 ADSIATEGDEAVDAEYVGISGAEDEFIEL-----------------PSRDTVESNMSHVLDRSDH 501

Human   833 QESKEANSSPGLGTPLKSP--SLAKKDSLISESELSQYFAHDVPGPLSDFMVA--GSEDE----- 888
            ......:..|.:     ||  .|....|||...:...........|.::...|  ||:.|     
  Fly   502 SGGLTKDQVPRI-----SPIVPLTNGRSLILADDSGNDTDEQCAEPETETAQARKGSKPETERVK 561

Human   889 DHPGSGCSTSEEGSLPPS---TSTHKEPGK---PRANSLVTLGSHRASGLFHKQVTVARQASLPG 947
            |...:...|..:..|.|.   |.|::.|.|   |.|.||..........|   :.||..:..:..
  Fly   562 DLGDTKTDTDPDPDLDPGQMPTPTNEAPVKAASPTAASLRVAWKSLGISL---EGTVDVECGIEK 623

Human   948 SPQALRNPLLRQRKVGCYDANDASDEEEFDREGDCI------SLPGALPGPIRPLSEDDPRRVSI 1006
            .|......:|....||         .:...|.||.:      .|.|.....:..:.::.|.||.:
  Fly   624 RPHHYIRSILADGPVG---------RQGILRPGDELLQVNEHKLQGLRHIEVVKILKELPARVKL 679

Human  1007 SSSKGM---DVHNQEERPRKTLVSKAISAPLLGSSVDLEESIPEGMVDAASY---AANLTDSAEA 1065
            ..::|.   .|.|..:.| :...::::   |.|....|:..:.:...:::.|   .|.|||:..|
  Fly   680 VCARGTHVPSVINTSQNP-EAFETRSL---LPGGHQSLQNLLSKAQSESSLYTSSTATLTDAGAA 740

Human  1066 PKGSPGSWWKKELSGSSSAPKLEYTVRTDTQSPTNTGSPSSPQQKSEGLGSRHRPVARVSP---- 1126
            ..||.|                                       :.|.|:|.:.:..||.    
  Fly   741 AGGSGG---------------------------------------TAGGGARSKSLENVSGLALW 766

Human  1127 HCKRSEAEAKPS----GSQTVNLTGRANDPCDLDSRVQATSVKVTVAGFQPGGAVEKESLGKLTT 1187
            .|:.:..:.:.:    |...::.    .||.|.:..|      :.:.|...|||.  |:..::..
  Fly   767 SCEVTAVDIEKTEQGFGFSILDY----QDPLDSEGSV------IVIRGLIRGGAA--EATNEIYP 819

Human  1188 GDACVSTSCELASALSHLDASHLTENLPKAASELG-QQPMTELDSSSDL-ISSP 1239
            ||..:|....|...|...:|..:.:.:|...:.|| .:|::..||:|:. |:||
  Fly   820 GDRLMSVGDRLLQGLELDEAVSILKAMPPGLTRLGICRPLSASDSNSNSNIASP 873

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PDZD2XP_005248326.1 PDZ_signaling 335..416 CDD:238492 31/81 (38%)
PDZ_signaling 589..670 CDD:238492 30/84 (36%)
PDZ_signaling 726..810 CDD:238492 9/84 (11%)
PDZ_signaling 2623..2694 CDD:238492
PDZ 2785..2867 CDD:214570
CG15803NP_001287388.1 PDZ_signaling 17..89 CDD:238492 30/77 (39%)
PDZ 307..393 CDD:214570 30/91 (33%)
PDZ_signaling 605..680 CDD:238492 15/87 (17%)
PDZ 773..858 CDD:214570 19/97 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I4699
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.