DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: IGSF9B and rst

Sequence 1:XP_011540993.1 Gene:IGSF9B HGNCID:32326 Length:1539 Species:Homo sapiens
Sequence 2:NP_001284835.1 Gene:rst FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster

Alignment Length:595 Identity:122/596 (20%)
Similarity:201/596 (34%) Gaps:141/596 (24%)


Human    86 LLVVCAPEMERGPVTCTQAQTVRGRTGHRRRFGPGAHGLREEPEFVTARAGESVVLRCDVIHPVT 150
            ||......:...|.|..|.|          ||.       .||:..||..|..|.|.|.||:   
  Fly     9 LLATIVGMVRSSPYTSYQNQ----------RFA-------MEPQDQTAVVGARVTLPCRVIN--- 53

Human   151 GQPPPYVVEWFK--FGV----PIPIFIKFGYYPPHVDPEYAGRASLHDKASLRLEQVRSEDQGWY 209
               ....::|.|  ||:    .:..|.::.......:.:|          ||.:..|..:|...|
  Fly    54 ---KQGTLQWTKDDFGLGTSRDLSGFERYAMVGSDEEGDY----------SLDIYPVMLDDDARY 105

Human   210 ECKVLMLDQQYDTFHNGSWVHLTINAPPTFTE-TPPQYIEAKEGGSITMTCTAF-GNPKPIVTWL 272
            :|:|....:......: ::..||:..||...: |....|.|.|...:.:.|.:. |.|...:||:
  Fly   106 QCQVSPGPEGQPAIRS-TFAGLTVLVPPEAPKITQGDVIYATEDRKVEIECVSVGGKPAAEITWI 169

Human   273 KE-GTLLGASGKYQV----------SDGSLTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGP 326
            .. |.:|..:.:|.|          :...|.:|.........::|:|.:.......:..:.|:  
  Fly   170 DGLGNVLTDNIEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQNTADRTYRSAKIRVE-- 232

Human   327 PFIVSPPENITVNI------------------------------SQDALLTCRAEAYPGNLTYTW 361
               |.....:.||:                              .....|.|||:|.|.::.|.|
  Fly   233 ---VKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECRADANPSDVRYRW 294

Human   362 YWQDENVYFQNDLKLRVRILIDGTLIIFRVKPEDSGKYTCVPSNSLGRSPSASAYLTVQYPARVL 426
            :..||.:......::.:|.:         .:........|...||:|:|.. |..|.:.|.....
  Fly   295 FINDEPIIGGQKTEMVIRNV---------TRKFHDAIVKCEVQNSVGKSED-SETLDISYAPSFR 349

Human   427 NMPPVIYVPVGIHGYIRCPVDAEPPATVVKW--NKDGRPLQVEKNLGWTLMEDGSIRIEEATEEA 489
            ..|..:...||....:.|.||:.|...:| |  :...|.:....||.:::           :.|.
  Fly   350 QRPQSMEADVGSVVSLTCEVDSNPQPEIV-WIQHPSDRVVGTSTNLTFSV-----------SNET 402

Human   490 LGTYTCVPYNTLGTMGQSAPARLVLKDPPYFTVLPGWEYRQE--AGRELLIPCAAAGDP-FPVIT 551
            .|.|.| ..|..|....||.|.:.||..|..    |.:..|.  .|....|.|.|:..| ...::
  Fly   403 AGRYYC-KANVPGYAEISADAYVYLKGSPAI----GSQRTQYGLVGDTARIECFASSVPRARHVS 462

Human   552 WRKVGK--PSRSKH------SALPSG---SLQFRALSKEDHGEWECVATN----------VVTSI 595
            |...|:  .|.|.|      .|:|.|   :|..|......:|::.|...|          :....
  Fly   463 WTFNGQEISSESGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKK 527

Human   596 TASTHLTVIG 605
            :.|..:|::|
  Fly   528 SVSLLMTIVG 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IGSF9BXP_011540993.1 IG_like 128..213 CDD:214653 21/91 (23%)
Ig 139..213 CDD:143165 17/80 (21%)
I-set 237..323 CDD:254352 18/99 (18%)
IGc2 251..308 CDD:197706 13/69 (19%)
I-set 327..419 CDD:254352 21/122 (17%)
Ig 333..419 CDD:299845 20/116 (17%)
IG_like 429..512 CDD:214653 21/85 (25%)
Ig <451..512 CDD:299845 14/63 (22%)
IG_like 524..603 CDD:214653 22/103 (21%)
Ig 533..603 CDD:299845 20/92 (22%)
FN3 608..703 CDD:238020
FN3 719..801 CDD:238020
rstNP_001284835.1 IG_like 34..130 CDD:214653 24/113 (21%)
Ig 42..114 CDD:299845 19/88 (22%)
C2-set_2 135..225 CDD:285423 17/90 (19%)
Ig_3 265..329 CDD:290638 12/73 (16%)
I-set 346..420 CDD:254352 19/87 (22%)
Ig 360..425 CDD:299845 19/78 (24%)
Ig5_KIRREL3-like 428..524 CDD:143235 21/100 (21%)
IG_like 435..524 CDD:214653 19/89 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.