DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ARSG and CG7402

Sequence 1:XP_011522838.1 Gene:ARSG HGNCID:24102 Length:552 Species:Homo sapiens
Sequence 2:NP_649023.1 Gene:CG7402 FlyBaseID:FBgn0036768 Length:579 Species:Drosophila melanogaster

Alignment Length:591 Identity:148/592 (25%)
Similarity:219/592 (37%) Gaps:142/592 (24%)


Human     8 VLLAGVSFSGFLYPLVDFCISGKTRGQKPNFVIILADDMGWGDLGANWAETKDTANLDKMASEGM 72
            |||...|.....|        |.....|||.||||.||||..|:..:.:....|.|:|.:|..|:
  Fly     8 VLLVVSSILSLAY--------GSGYSTKPNIVIILIDDMGMNDVSFHGSNQILTPNIDALAYNGI 64

Human    73 RFVDFHAAASTCSPSRASLLTGRLGLRNGVTRNFAVT-SVGGLPLNETTLAEVLQQAGYVTGIIG 136
             .::.|...:.|:||||:||||:..:..|:.....:| ...|||..|..:.|:.:.|||.|.::|
  Fly    65 -LLNKHYVPNLCTPSRATLLTGKYPIHTGMQHFVIITDEPWGLPQRERLMPEIFRDAGYSTHLVG 128

Human   137 KWHLGH-HGSYHPNFRGFDYYFGI------PYSHDMGCTD---TPGYNH----PPCPACPQGDGP 187
            |||||. .....|..||||::||.      .|.|.:...|   :.|.:.    .|||        
  Fly   129 KWHLGFWRKDLTPTMRGFDHHFGYYNGYIDYYDHQVRMLDRNYSAGLDFRRDLEPCP-------- 185

Human   188 SRNLQRDCYTDVALPLYENLNIVEQPVNLSSLAQKYAEKATQFIQRASTSGRPFLLYVALAHMHV 252
                                     ..|.:...:.:..:|.:.|::...| :|  |::.|:|:.|
  Fly   186 -------------------------EANGTYATEAFTSEAKRIIEQHDKS-KP--LFMVLSHLAV 222

Human   253 -------PLPVTQLPAA-------PRGRSLYGAGLWEMDSLVGQ-IKDKVDHTVKENTFLWFTGD 302
                   |:...:...|       |:.|: |...:..:|..|.| |....|:.:..|:.:....|
  Fly   223 HTGNEDSPMQAPEEEVAKFPHIRDPKRRT-YAGMISSLDKSVAQTIGALKDNGMLNNSIILLYSD 286

Human   303 NG-PWAQKCELAGSVGPFTGFWQTRQGGSPAKQTTWEGGHRVPALAYWPGRVPVNVTSTALLSVL 366
            || |.......|||..|:.|          .|::.||||.|.....:.|........|...:..:
  Fly   287 NGAPTIGIHSNAGSNYPYRG----------QKESPWEGGIRSAGALWSPLLKERGYVSNQAIHAV 341

Human   367 DIFPTVVALAQASLPQGRRFDGVDVSEVLFGRSQPG-----HREEEAGG---------------- 410
            |..||:...|..||||....||:::..:|.|..:|.     |..:|..|                
  Fly   342 DWLPTLAGAAGVSLPQDLPLDGINLWPMLSGNEEPKPRTMIHVLDEVFGYSSYMRDTLKYVNGSS 406

Human   411 ---------GKEAEGAQSPLCNALQMHGFLVLFHPNSGAAGEFGALQ-TVRLERYKAFYITGGAR 465
                     |:.......||..:.:.|   ||........|..|..: .:|..|.:|      ..
  Fly   407 FKGRYDQWLGELETNEDDPLGESYEQH---VLASDVQSLLGNRGLTKDRIRQMRSEA------TE 462

Human   466 ACDGSTG--PELQH------KFPLIFNLEDDTAEAVPLERGGAEYQAVLPEVRKVLADVLQDIAN 522
            .|....|  |...|      |.|..|:|..|..|...|.:       :.|...:.|||.|:.|..
  Fly   463 TCPPIEGQNPLESHFKCEPLKAPCFFDLAKDPCERYNLAQ-------MYPLQLQQLADELEQIRK 520

Human   523 DNISSA 528
            ..|.||
  Fly   521 TAIPSA 526

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ARSGXP_011522838.1 ARSG 35..496 CDD:293780 133/531 (25%)
AslA 35..457 CDD:225661 121/484 (25%)
CG7402NP_649023.1 PRK13759 25..459 CDD:237491 121/485 (25%)
4-S 28..436 CDD:293753 116/459 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87580142
eggNOG 1 0.900 E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.