DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: NLGN1 and Gli

Sequence 1:NP_001352852.1 Gene:NLGN1 HGNCID:14291 Length:843 Species:Homo sapiens
Sequence 2:NP_476602.1 Gene:Gli FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster

Alignment Length:821 Identity:225/822 (27%)
Similarity:349/822 (42%) Gaps:178/822 (22%)


Human    46 QKLDDV----DPLVATNFGKIRGIKKELN----------------NEILGPVIQFLGVPYAAPPT 90
            |:.|.:    |..|.||:|:::|.|..:.                :.::|....|||:|||.|||
  Fly   124 QRRDSLTLERDVFVTTNYGQVQGFKVYMYDNPDPKSFYRPYHSTVDRVMGECSVFLGIPYALPPT 188

Human    91 GERRFQPPEPPSPWSDIRNATQFAPVCPQNIIDGRLPEVMLPVWFTNNLDVVSSYVQDQSEDCLY 155
            .|.||:||.....| .:..|..|.|.|||            ||.:|.    .:..:.|..|||||
  Fly   189 FEGRFKPPRVHRGW-QLLQAVDFGPACPQ------------PVRYTG----ATKGIMDMDEDCLY 236

Human   156 LNIYVPTEDGPLTKKQTDDLGDNDGAEDEDIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLASY 220
            ||:|.|.....:.:|.                      |||||||||.::.|..||:.|.:|||:
  Fly   237 LNVYSPKTGAGVAQKY----------------------PVMVYIHGGEFIRGASNLFQGHILASF 279

Human   221 GNVIVITVNYRLGVLGFLSTGDQAAKGNYGLLDLIQALRWTSENIGFFGGDPLRITVFGSGAGGS 285
            .:|:|:|:|||||.||||||||:.:.||||:||...||||..:||.||.||...||:||.||||:
  Fly   280 YDVVVVTLNYRLGALGFLSTGDENSPGNYGILDQAMALRWVYDNIEFFNGDRNSITLFGPGAGGA 344

Human   286 CVNLLTLSHYSEGNRWSNSTKGLFQRAIAQSGTALSSWAV---SFQPAKYARMLATKVGCNVSDT 347
            ...||.:         :..|:.:.:|.|||||:||:.||:   .::....:|:|...:||::..:
  Fly   345 SAGLLMV---------APQTRNIVRRVIAQSGSALADWALIQDKYRAQNTSRVLGQLLGCSIESS 400

Human   348 VELVECLQK-KPYKELVDQDIQPARYHIAFGPVIDGD-VIPDD-----------------PQILM 393
            .:||.||:. :.:.||.:.:..|......:|||:|.: .:|.|                 |:.|:
  Fly   401 WKLVNCLRTGRSFYELGNAEFSPQVGSFPWGPVLDHNFTLPGDDWYEGWREKDWRFLTQTPETLI 465

Human   394 EQGEF-LNYDIMLGVNQGEGLKFVENIVDSDDGIS------ASDFDFAVSNFVDNLYGYPEGKDV 451
            ..|:| .|...|.||...|...||.    .::.:|      ...||..:...|.. |.|....:.
  Fly   466 RAGKFNRNIQYMTGVTTQEAAFFVA----QNESLSPYYELDGRFFDQKIREHVFR-YNYTLNPNG 525

Human   452 LRETIKFMYTDWADRHNPETRRKTLLALFTDHQWVAPAVATADLHSNFGSPTYFYAFYHHCQTDQ 516
            :.|.||::||.|.|.:|....|...:.:.:|..:.||......|......|.|.|......:...
  Fly   526 VYEAIKYIYTFWPDPNNNTIIRDQYINMLSDLYYRAPVDQMVKLMLEQKVPVYMYVLNTTVEALN 590

Human   517 VPAWADAAHGDEVPYVLGIPMIGPTELFPCN-------FSKNDVMLSAVVMTYWTNFAKTGDPNQ 574
            :|.|....|..|..::.|.|.: .||.||..       ::.||..:|...|..:||||:.|:   
  Fly   591 LPQWRKYPHDIERYFLTGAPFM-DTEFFPKKEHLQRNMWTDNDRNMSHFFMQTYTNFARYGN--- 651

Human   575 PVPQDTKFIHTKPNRFEEVAWTRYSQKDQLYLHIG--LKPRVKEHYRANKVNLWLELVPHLHNLN 637
            |.||....:|          :.|..|.:..||:|.  ....:..:||..:...|.:.:|.:..: 
  Fly   652 PTPQQVLGMH----------FQRAYQGEIRYLNINTTYNSSILLNYRQTECAFWTQYLPTVIGV- 705

Human   638 DISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELSVTIAV 702
                  ...|..|:|:..:.|..    |:..||                         .|:::| 
  Fly   706 ------LVPTYPPTTEYWWEPKE----PLQIAF-------------------------WSMSVA- 734

Human   703 GASLLFLNIL-AFAALYYKKDKRRHDVHRRCSPQRTTTNDLTHAQEEEIMSLQMKHTDLDHEC-- 764
               ..||.:| ....:.::..||:.|   |...:....|......|::...:...|...:|..  
  Fly   735 ---CFFLIVLVVICCIMWRNAKRQSD---RFYDEDVFINGEGLEPEQDTRGVDNAHMVTNHHALR 793

Human   765 --ESIHPHEVVLRTACPPDYTLAMRRSPDDVPLMTPNTITM 803
              ::|:.:.     ..|...|||.:...|...|.:|:::.|
  Fly   794 SRDNIYEYR-----DSPSTKTLASKAHTDTTSLRSPSSLAM 829

Known Domains:


GeneSequenceDomainRegion External IDIdentity
NLGN1NP_001352852.1 COesterase 52..626 CDD:306613 192/628 (31%)
GliNP_476602.1 COesterase 134..695 CDD:278561 192/628 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D754103at2759
OrthoFinder 1 1.000 FOG0000341
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR43903
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.