DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: PPP6R1 and fmt

Sequence 1:NP_055746.3 Gene:PPP6R1 HGNCID:29195 Length:881 Species:Homo sapiens
Sequence 2:NP_001261470.1 Gene:fmt FlyBaseID:FBgn0035688 Length:996 Species:Drosophila melanogaster

Alignment Length:1083 Identity:245/1084 (23%)
Similarity:396/1084 (37%) Gaps:342/1084 (32%)


Human     1 MFWKFDLHTSSHLDTLLEREDLSLPELLDEEDVLQECKVVNRKLLDFLLQPPHLQAMVAWVTQEP 65
            |||......|::::.|||:|:.:|.|.|||||:|||||...:.|:::..:|..::.:|..:|.||
  Fly     1 MFWDKGYAPSANIEALLEKENSTLEEFLDEEDILQECKTQKKNLVNYFTRPEVIRRLVELITTEP 65

Human    66 PDSGEERLRYKYPSVACEILTSDVPQINDALGADESLLNRLYGFLQSTGSLNPLLASFFSKVMGI 130
            .:......|::|.:::|||||..:|.:::.|..|...|..||.:|:....|||||:|||||...:
  Fly    66 SEDVPMSKRFRYANMSCEILTLGLPSLDEKLLNDAETLQLLYSYLEKEPPLNPLLSSFFSKTFSM 130

Human   131 LINRKTD-----------QLVSFLRKKDDFVDLLLQHIGTSAIMDLLLRLLTCVERPQLRQDVVN 184
            |..:|.:           ||:.:::.:..|:|.:.:|..|..|.||:::::..:|..:|::::..
  Fly   131 LFTKKPEQDWFLYQHMCLQLLEYIKSQKTFLDFICKHFDTPVIPDLIMQMMKDIEGGRLKRNLFE 195

Human   185 WLNEEKIVQRLIEQIHPSKDENQHSNASQSLCDIIRLSR--EQMIQVQDSPEP-----DQLLATL 242
            ||.|:|||:|||..:...::.::|:|.:...||:|...|  .|..|..||.||     :.:|.|:
  Fly   196 WLTEDKIVERLIAILRNPQETDKHANVADFFCDLINQGRLMRQTEQENDSFEPAFDGSNPILKTI 260

Human   243 EKQETIEQLLSNMFEGEQSQSVIVSGIQVLLTLLEPRRPRSESVTVNSFFSSVDGQLELLAQGAL 307
            |..:|||.||:.:.|....:|.|:|||.|:|||::|.....|.   ||....:..:.|......:
  Fly   261 EFADTIEALLNVILEPNAQESAILSGISVVLTLIKPITFTDEP---NSDRQRLLQKREREIHQEV 322

Human   308 ESTVSSVGALHALRPRLSCFHQLLLEPPKLEPLQMTWGMLAPPLGNTRLHVVKLLASALSANDAA 372
            :.||.:|     :.|||..|..:|..||....|:.|..:|.||.|.|||.|.::..:.|......
  Fly   323 QETVITV-----MAPRLQEFVHILKNPPAKPTLETTAAVLTPPFGKTRLQVCRVFTALLETKHET 382

Human   373 LTHELLALDVPNTMLDLFFHYVFNNFLHAQVE---------------------------GC-VST 409
            :...:.|.:..:.:||.|..|.:|||||.::|                           .| ::.
  Fly   383 IQQAICATEYFSLLLDFFKQYCWNNFLHTEMEKALYVVFYNELSNNNTASTEVTDYFTADCLINA 447

Human   410 MLSLG------------------------------------------------------------ 414
            .|.:|                                                            
  Fly   448 FLKVGTEESEVEMKNALNDAKRAEGGKDEEGGDIEIEVAAAQEVAAQTPDERQTAAEENQEHEEH 512

Human   415 -----------PPPDSSPE------------------------------------TPIQNPVVKH 432
                       ...|:.|:                                    :|..:.:..|
  Fly   513 MSQVEAAAEATASEDAEPKAQDNEVKNSEVDGESPTDQQESEATLNDLDKTKTVPSPPPSEMQSH 577

Human   433 LLQQCRLVERILTSWEENDRVQCA-GGPRKGYMGHLTRVAGALVQNTEKGPNAEQLRQLLKELPS 496
            |:..|.|:.:::..|:.|.:.|.| .|.|.||||||.::   |...|.....:|.:..|:....|
  Fly   578 LIVNCHLISKLVDLWQHNAQAQSAEKGRRLGYMGHLIKI---LRHITNCISESEHIGDLITSSLS 639

Human   497 EQQE--QWEAFVSGPLAETNK-----KNMVDLV---NTHHLHSSSDDEDDRLKEFNFPEEAVLQQ 551
            ::.|  .|::.:.   |||.:     |....|:   |.|..:..:|..:|...|.|......|  
  Fly   640 DEDEVKLWQSLID---AETGEFSLAVKQQTKLLADCNPHEENQYNDGSNDYTGEINAWNVGNL-- 699

Human   552 AFMDFQMQRMTSAFIDHFGFNDEEFGEQEESVNAPFDKTANITFSLNADDENPNANLLEICYKDR 616
            .:.:.....:.:...|.|...|:.                ...|..|.|||              
  Fly   700 PYREVDCSELNNTLQDIFFAIDQN----------------RFQFGRNIDDE-------------- 734

Human   617 IQQFDDDEEEEDEEEAQGSGESDGE-----------DGAWQ------------------------ 646
                |||::|..:....|.|...|.           ...|.                        
  Fly   735 ----DDDDDEHGDHSGGGDGHGHGMFTKNSNTLNNLADPWDIQFAVLSSAPTQVNTGTANWGTDF 795

Human   647 ---------------GSQLARGARLGQPPGVRSGGSTDSEDEEEEDEEEEEDEEGIGCAARGGAT 696
                           ||.|  |..:..|||                ||||||.            
  Fly   796 NSDNFADFDAHFSTFGSDL--GMPISAPPG----------------EEEEEDS------------ 830

Human   697 PLSYPSPGPQPPGPSWTATFDPVPTDAPTSPRVSGEEELHTGPPAPQGPLSVPQGLPTQSLASPP 761
                 ||.|:                  ::.:|:.|||..   ||....|:|.:|: ..:||...
  Fly   831 -----SPAPE------------------SATQVNPEEERQ---PAESIGLAVGKGV-QDNLACTD 868

Human   762 ARDALQLRSQDPTPPSAPQEATEGSKVTEPSAPCQALVSIGDLQATFHGIRSAPSSSDSATRDPS 826
            .:.|..  ..:.....|..:....|.|.|.:|....|.|:            .....|....|..
  Fly   869 DQQAEY--DNNANVEKAISDKLAESSVVETAAIVTRLQSV------------LLDGEDDYEDDEG 919

Human   827 TSVPASGAHQPPQT---TEGEKSPE----PLGLPQSQSAQALT 862
            ......||.:|.:|   |.....|:    .||||.|..|..::
  Fly   920 MWTKPLGADRPSETEQITPISNGPDSKVNELGLPFSNHANDIS 962

Known Domains:


GeneSequenceDomainRegion External IDIdentity
PPP6R1NP_055746.3 Interaction with PPP6C 10..403 135/411 (33%)
SAPS 128..519 CDD:282368 122/552 (22%)
PHA03195 <742..>875 CDD:177556 27/129 (21%)
fmtNP_001261470.1 SAPS 129..465 CDD:282368 92/344 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C40113598
eggNOG 1 0.900 E1_KOG2073
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 287 1.000 Inparanoid score I2793
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000556
OrthoInspector 1 1.000 T608618
orthoMCL 1 0.900 OOG5_128556
Panther 1 1.100 O PTHR12634
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R385
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.