DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CHSY1 and CG9220

Sequence 1:XP_011519666.1 Gene:CHSY1 HGNCID:17198 Length:830 Species:Homo sapiens
Sequence 2:NP_001285280.1 Gene:CG9220 FlyBaseID:FBgn0030662 Length:832 Species:Drosophila melanogaster

Alignment Length:862 Identity:338/863 (39%)
Similarity:484/863 (56%) Gaps:133/863 (15%)


Human     9 WLSVLLGLVLGFVLASRLVLP--RASELKRAGPRRRASPEGCRSGQAAASQAGGARGDARGAQLW 71
            :..:.|||.:|.:|.:.|.|.  :...|:....:..|...|.|......:.              
  Fly    16 FFGIALGLCIGTMLKNYLALEIVKRCSLRPTNLKTPADIIGLRDEDTIQNS-------------- 66

Human    72 PPGSDPDGGPRDRNFLFVGVMTAQKYLQTRAVAAYRTWSKTIPGKVQFFSSEGSDTSVPIPVVPL 136
                       .||.:|||||||:.:|:.||.|.|.||.|.:||::.||||||| .|..:|||.|
  Fly    67 -----------QRNLVFVGVMTAKSFLEGRARAVYDTWGKEVPGRMAFFSSEGS-YSDDLPVVGL 119

Human   137 RGVDDSYPPQKKSFMMLKYMHDHYLDKYEWFMRADDDVYIKGDRLENFLRSLNSSEPLFLGQTGL 201
            :.|||.|||||||||||.||::||:|::|||:|||||||::.|:||.||||::||:|.|:||.|.
  Fly   120 KNVDDRYPPQKKSFMMLYYMYEHYIDRFEWFIRADDDVYMEPDKLERFLRSIDSSKPQFIGQAGK 184

Human   202 GTTEEMGKLALEPGENFCMGGPGVIMSREVLRRMVPHIGKCLREMYTTHEDVEVGRCVRRFAGVQ 266
            |.:||.|.|:||..|||||||||||:|.|.|||:.|||..||:.:|:|||||||||||::|||:.
  Fly   185 GNSEEFGLLSLEFDENFCMGGPGVILSSETLRRVAPHIPSCLKNLYSTHEDVEVGRCVQKFAGIP 249

Human   267 CVWSYEASPVACLCQCLRHSLFLMILTVLRSASQMQQLFYENYEQNKKGYIRDLHNSKIHQAITL 331
            |.|:||...:      |||:                       ...:..|...|...:||.||||
  Fly   250 CTWNYEMQYI------LRHN-----------------------SSGRNAYTGKLKRKEIHNAITL 285

Human   332 HPNKNPPYQYRLHSYMLSRKISELRHRTIQLHREIVLMSKY------------------SNTEIH 378
            ||.|..|..||||||:...|..|:|..::.|||:|..|:||                  .:|:.|
  Fly   286 HPIKQAPLMYRLHSYVQGLKAEEMRQESLLLHRDIKRMAKYLEVPDESTYMLPSVSPESDSTKRH 350

Human   379 KEDLQ-LGIPPSFMRFQPRQREEILEWEFLTGKYLYSAVDGQPPRRGMDSAQREALDDIVMQVME 442
            .:|.. |||.|...:|.|...:::|:|.|: .:.||||....|.:: :|||.||.|:|.:.:|||
  Fly   351 FQDHNILGISPELNKFVPASTDDLLDWSFI-ARSLYSASSANPKQK-IDSAMREGLEDAITEVME 413

Human   443 MINANAKTRGRIIDFKEIQYGYRRVNPMYGAEYILDLLLLYKKHKGKKMTVPVRRHAYLQQTFSK 507
            .||..::.|||:|:|:|:.|||.|::.::|.:.||||||:|||::|||||||||||.|:|:.|:.
  Fly   414 NINNYSRQRGRVIEFRELLYGYHRLDALHGQDMILDLLLIYKKYRGKKMTVPVRRHLYVQRAFTG 478

Human   508 IQFVEHEELDAQELAKRINQESGSLSFLSNSLKKLVP-FQLPGSKSEHKEPKDKKINILIPLSGR 571
            | ||:..:.|...:..   |:|...|...|.:.:|.. |.:|   |....|...||..::|::||
  Fly   479 I-FVKEVDEDFYNVTL---QQSLLGSLFQNGMARLSSHFTMP---SGLLSPTQDKIVFVLPIAGR 536

Human   572 FDMFVRFMGNFEKTCLIPNQNVKLVVLLFNSDSNPDK-AKQVELMRDYRIKYPKADMQILPVSGE 635
            ...|.||:..:|:.|:...|:..|:|::|.|   ||: ...::|:.|...::....:..:..|..
  Fly   537 LGTFERFLRTYERVCVRGEQHCDLLVVIFGS---PDELGDHLQLLHDLHARHVYQQVNWIQRSSA 598

Human   636 FSRALALEVG--SSQFNNESLLFFCDVDLVFTTEFLQRCRANTVLGQQIYFPIIFSQYDPK---- 694
            |||.:||:|.  ||....|.::.|.|||:||..|.|||.|.:|..|:|:|.||:||||||:    
  Fly   599 FSRGVALDVAARSSYIRQEDIILFIDVDMVFEVETLQRVRMHTQRGKQVYLPIVFSQYDPQRRSG 663

Human   695 ----IVYSGKVPSDNHFAFTQKTGFWRNYGFGITCIYKGDLV--RVGGFDVSIQGWGLEDVDLFN 753
                ....|:.|     ....:.|::|.:||||..|||.|::  .:.|||..|.|||||||....
  Fly   664 DAGGSEDEGETP-----RIDDERGYFRQFGFGICAIYKSDILDEDINGFDKDITGWGLEDVKFLE 723

Human   754 KVVQAG--------------------------LKTFRSQEVGVVHVHHPVFCDPNLDPKQYKMCL 792
            |:|:.|                          |..||:.:..:||::|.:.||..||..||.|||
  Fly   724 KIVRVGTRQRGFLANTAELAMDYNEAAEQWRRLSVFRAPDPTLVHIYHDISCDVQLDAPQYNMCL 788

Human   793 GSKASTYGSTQQLAEMW 809
            |:||::.|||:.:.:::
  Fly   789 GTKANSLGSTRLMEQLF 805

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CHSY1XP_011519666.1 Galactosyl_T 87..>265 CDD:304462 115/178 (65%)
CHGN 238..805 CDD:283361 229/626 (37%)
CG9220NP_001285280.1 Galactosyl_T 71..>251 CDD:304462 116/181 (64%)
CHGN 221..799 CDD:283361 229/624 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87627522
eggNOG 1 0.900 E1_KOG3588
Hieranoid 1 1.000
Homologene 1 1.000 H8950
Inparanoid 1 1.050 601 1.000 Inparanoid score I938
Isobase 1 0.950 0.938488 Normalized mean entropy S4160
OMA 1 1.010
OrthoDB 1 1.010 D211685at33208
OrthoFinder 1 1.000 FOG0002811
OrthoInspector 1 1.000 T609259
orthoMCL 1 0.900 OOG5_132390
Panther 1 1.100 O PTHR12369
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3461
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1514.750

Return to query results.
Submit another query.