DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SCAF8 and CG4266

Sequence 1:NP_001273117.1 Gene:SCAF8 HGNCID:20959 Length:1349 Species:Homo sapiens
Sequence 2:NP_001097394.1 Gene:CG4266 FlyBaseID:FBgn0034598 Length:1306 Species:Drosophila melanogaster

Alignment Length:1470 Identity:430/1471 (29%)
Similarity:594/1471 (40%) Gaps:448/1471 (30%)


Human    79 MEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYV 143
            ||.|..||:||..|.|.:||||||||..|||:|::|||.||||||||||||.|||||||||||||
  Fly     1 METVVAFNNELSGLYDSRPPISKAKMAAITKSAMRAIKLYKHVVQSVEKFILKCKPEYKVPGLYV 65

Human   144 IDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQP 208
            |||||||||||:|.:||:|||||..|:..||.||:||..:|||:|:|||||||||||||||:|||
  Fly    66 IDSIVRQSRHQYGMDKDLFAPRFQRNLTETFANLFRCAPEDKSRIIRVLNLWQKNNVFKSEVIQP 130

Human   209 LLDMAAGIPPPVVTPVLASTTTAMSNTPGTPVTPVTPANVVQGLPDPWVSQITNTDTLAAVAQIL 273
            :.|:|                     .|..|:....|.....|.....|....::....::|.|.
  Fly   131 IFDLA---------------------DPNHPIYHQMPPVGGSGGQGGGVGPGPSSSGALSLADIS 174

Human   274 QSPQGQQLQQLIQTLQIQQQKPQPSILQALDAGLVVQLQALTAQLTAAAAAANTLTPLEQGVSFN 338
            ..|.|..                       .:|:.:.:.:.........|    :..|..|    
  Fly   175 SGPNGLN-----------------------SSGMEISMNSSGGDDKMGGA----MPDLSLG---- 208

Human   339 KKLMDRFDFGEDS---EHSEE--PKKEIPASQLSHVSES---------VNNSIFHQIAEQLQQQ- 388
               .::|..|..|   .:||:  .|::...|..|..|:|         .::.|.:|:.|.:::: 
  Fly   209 ---HEKFGGGSSSSKRHYSEQHYSKRQSVVSCSSKTSKSHHHKREYVKSSHDIDYQVREIIEEED 270

Human   389 -----------------------------------NLEHLRQQLLEQQQPQKATPQ-DSQEGTFG 417
                                               |..::.:||...|..|...|| ::|:..:.
  Fly   271 EGLQMLMADDHHCMGDDSPPTSSNLLDEKKIKQLLNNPNVLRQLHTLQNFQNLKPQEENQKHRYQ 335

Human   418 SEHSASPSQGSSQQHF---------LEP----EVNLDDSIDIQQQDMDIDEGQ-------DGVEE 462
            .|        :.||||         :.|    .:|::||:|:.:....|.|.|       ||.:.
  Fly   336 DE--------ALQQHFQNVMKGNAGMPPGMGMGMNMNDSMDLNKDVEFISEQQTIEVINLDGGDS 392

Human   463 EVFEQEAKKVAVRSRSRTHSRSRSRSPRKRRSRSRSGSRKRKHRKRSRSRSR----ERKRKS--- 520
            .....:..:.   .|||.:||||:||||.|.:...:|:.:|:...|||||||    .|:|.|   
  Fly   393 RSPTPDRDRY---KRSRRNSRSRTRSPRGRGAGGGTGNDRRRRGTRSRSRSRSPRSSRRRGSRDR 454

Human   521 ---SRSYSSERRAREREKERQKKGLPPIRSKTLSVCSTTLWVGQVDKKATQQDLTNLFEEFGQIE 582
               .||...:.|.||.|:||:|||||.|:.:.|||||||||||.:.|...|::|::.|.|:|.|.
  Fly   455 DRMDRSNRDKERDREHERERRKKGLPDIKKEHLSVCSTTLWVGHLSKLVYQEELSDTFGEYGDIV 519

Human   583 SINMIPPRGCAYVCMVHRQDAFRALQKLSSGSYKIGSKVIKIAWALNKGVKT-EYKQFWDVDLGV 646
            ||:.|.|||||::.|..||||.:|:|.|.  ::|:..:.|.|:||..||||: |:|.:||::|||
  Fly   520 SIDQIVPRGCAFIVMNRRQDAHKAMQALK--NHKLQGRAITISWAAGKGVKSKEWKDYWDLELGV 582

Human   647 TYIPWEKVKVD-DLEGFAEGGMIDQETVNTEWETVKSSEPVKETVQTTQSPTPVEKETVVTTQAE 710
            |||||.|:..| |.:...||||.|::|:           |::...:..|:.. ..||....:.||
  Fly   583 TYIPWSKLSSDTDFDALEEGGMFDEDTM-----------PIQMKQKINQAKN-AAKEHKGASIAE 635

Human   711 VFPPPVAMLQIPVAPAVPTVSLVPP--AFPVSMPVPPP--GFSPIPPPPFLRASFNPSQPPPGF- 770
                         |...|:|.:.||  .|.:....|||  ...|:.|||      .|..||||. 
  Fly   636 -------------AAGAPSVGVPPPNLIFGIDTTQPPPVGPVGPVGPPP------GPGAPPPGLM 681

Human   771 --------MPPP----VPPPVVPPPT-IPP--VVPTSLVQPSLSMTPETVKDVGFGSLVIPGGSV 820
                    |.||    :|||::.||| :||  ::||:.:.|.: |.|.|:...||     ||  :
  Fly   682 GMVRGQFPMAPPMGINMPPPIMMPPTNMPPPMMMPTTNMPPPM-MMPPTMMPPGF-----PG--I 738

Human   821 ASNLATSALPAGNVFNAPTKQAEPEEKVPHLIDHQISSGENTRSVIPNDISSNAAILGGQPPNVT 885
            .......|||.|..|..|                         ..:|..|.|     |||    .
  Fly   739 GGPPHPMALPPGAPFPPP-------------------------GAVPPPIPS-----GGQ----I 769

Human   886 SNSGILGVQRPNVSSNSEILGVRPSNVSSSSGIIAAQPPNILNNSGILGIQPPSVSN-------- 942
            ||||       |||.:...:.:   ::..:..:...|..|...:...:.:.|.:::|        
  Fly   770 SNSG-------NVSDDQMDIEM---DLEDAPPLPPQQQANFNPSPSNVDLSPAAMANEMFQQRDR 824

Human   943 ---------SSGLLGVLPPNIPNNSGLVG-------VQPPNVPNTPGLLGTQPPAGPQNLPPLSI 991
                     |.|         |.||...|       .:.....|..|  |..|.:|   |.|.:.
  Fly   825 ERDRDNRDRSRG---------PGNSRWGGRDDVVEAAERWRAENGGG--GGGPGSG---LGPNAA 875

Human   992 PNQRMPTMPMLDIRPGLIPQAPGPRFPLIQPGIPPQRGIPPPSVLDSALHPPPRGPFPPGDIFSQ 1056
            .|:....:.:                      .|.:.|:|.|..:|......|.||...|     
  Fly   876 FNEARARLNL----------------------NPIEHGMPRPDFMDFDNRGGPGGPRGMG----- 913

Human  1057 PERPFLAPGRQSVDNVTNPEKRIPLGNDNIQQEGDRDYRFPPIETRESISR---------PPPVD 1112
                                   |.||.|....|. |: |||.......::         |||..
  Fly   914 -----------------------PRGNHNGGGPGG-DF-FPPNMNHNRFNQPTSLMQMRIPPPAS 953

Human  1113 VRDVVGRPIDPREGPGRPPLDGRDHFGRP---------PVDIRENLVRPGIDHLGRRDHFG-FNP 1167
            ....:|.|.. ..|.|..|:..|:..|.|         |.........||    ||:...| |||
  Fly   954 FNQRMGGPAG-NGGNGVGPMFMRNQGGGPGGAGPSGGGPGGAGTGGGGPG----GRQQGPGFFNP 1013

Human  1168 EKPW--GHRGDFDEREHRVLPVYGGPKGLHEERGRFR----SGNYRFDPRSGP----WNRGFGQE 1222
            ..|:  ..||...:....|..|.||..|....|||:.    .|...|..|.||    .||..|:.
  Fly  1014 RNPFNDNQRGRGGQSGGGVRGVGGGGGGGPGGRGRWSDDEDEGGNNFKRRGGPGGPGGNRFRGER 1078

Human  1223 VHRDFDDRR---RPWERQRDRDDRDFDFCREMNGNRLG------RDRIQ---------------- 1262
            .....||||   ....|...|:||:    |...|||.|      |..|.                
  Fly  1079 GGEMMDDRRGNNSRGGRGGPREDRE----RPGFGNRRGSRDDSNRHSISSTDEGNKAASETEPKP 1139

Human  1263 ----------NTWVPPPHARV----------FDYFEGATSQRKGDNVPQVNGENTERHAQPPPIP 1307
                      ||..|....||          .||.....:|:.        ||...:.|..||  
  Fly  1140 KNVETELGSTNTGAPAAATRVDTEEDWDQELQDYEARMEAQKP--------GERASQSANSPP-- 1194

Human  1308 VQNDPELYEKLTSSNEINKEKSDTVADIESEPVVESTETE 1347
                   .|||.:.|| |..|.   ||:..:|:|..::||
  Fly  1195 -------QEKLPAENE-NFAKP---ADVTGDPLVAKSQTE 1223

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SCAF8NP_001273117.1 CID 82..203 CDD:239621 90/121 (74%)
RRM <551..>630 CDD:223796 38/79 (48%)
RRM_SCAF8 553..631 CDD:240908 37/78 (47%)
CG4266NP_001097394.1 CID 7..125 CDD:239621 89/118 (75%)
RRM <488..>593 CDD:223796 55/107 (51%)
RRM_SCAF4_SCAF8 490..566 CDD:240673 37/78 (47%)
DUF2413 1147..>1254 CDD:287302 26/99 (26%)
Herpes_DNAp_acc <1206..1304 CDD:282746 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C358643517
eggNOG 1 0.900 E1_KOG0132
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 468 1.000 Inparanoid score I1509
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001380
OrthoInspector 1 1.000 T608499
orthoMCL 1 0.900 OOG5_130921
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1302
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
109.680

Return to query results.
Submit another query.