DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Pex6 and Pex6

Sequence 1:NP_663463.1 Gene:Pex6 MGIID:2385054 Length:981 Species:Mus musculus
Sequence 2:NP_001027403.2 Gene:Pex6 FlyBaseID:FBgn0033564 Length:899 Species:Drosophila melanogaster

Alignment Length:818 Identity:270/819 (33%)
Similarity:415/819 (51%) Gaps:157/819 (19%)


Mouse   264 GEPLADG------------LVFLPATLAFNL----GCDPLEVGELRIQRYLEGSIAP--ENKGSC 310
            |:|||..            |...|.|:...:    .|.|   ..|.:|....|:|..  :.:.:|
  Fly   136 GKPLASDEGNMTQTVIKQMLQEAPHTIVAQILPAAQCQP---NCLYVQENFYGNILDRFQIRSNC 197

Mouse   311 ----------SPLPGPPFARELHIEILSSPHYSANGNYDHVLYRHFQTPRVVQEG---------D 356
                      ..:||  .|.:.|:.:::.||.......:.:|..:|.|||::..|         :
  Fly   198 WVQVEHFADEQTIPG--IATKAHVYLVADPHELPAELTEVILSNYFNTPRLMHRGHTYRIEVNAE 260

Mouse   357 VLCVSTAGQVEILEGSLERLPRWREMFFK----------------VKKTVGEAPEGPAS-AFLAD 404
            ::..:|.....::...|      |.:..|                |.|......:.||| :||..
  Fly   261 LVGTATYAHYYLIFAHL------RHVHLKCIHLETKGSEFELQAIVAKNFSNLVQVPASHSFLPR 319

Mouse   405 TTHTSLYLAGTALSHVPSLPSGRSPPWDSLSPPGLEALVNELCAIL-KPHLQPGGTLLTGTSCVL 468
            ....|:.:       |.:.|||...|: .|....::|.:.:..|.| ..|:.|         ..|
  Fly   320 QVLDSMAI-------VENYPSGLRKPY-KLLRSSVDAFLPKKSACLSSKHIFP---------VFL 367

Mouse   469 LQGPPGSGKTTAVTAACSRLGLHLLKVPCSSLCADSSRAVETKLQATFSRARRCRPAVLLLTAVD 533
            |||..||||:..|:|....||:|:....|:.:.:......|.||:|.|::::.|.|.::.....:
  Fly   368 LQGERGSGKSKLVSAVAQELGMHIYGADCAEIVSQVPSHTEMKLKAVFAKSQVCEPLMICFHNFE 432

Mouse   534 LLGRDRDGLGEDARVAATLRHL----LLDEDALSRCPPLMVVATTSRVQDLPTDVQTAFPHELEV 594
            :.|.|.:| .||.|:.:.. |:    |.:.|   |..|::|||.||. :.|...:|..|...:.:
  Fly   433 IFGIDNEG-NEDLRLLSAF-HVQVQELFNRD---RKHPIVVVALTSD-RHLKPMIQGLFLEIINI 491

Mouse   595 PVLSEAQRLSIL---------------QALTAHLPLGQEVN------------------LPQLAR 626
            .:.|:.:|..||               |.....|||....|                  |..:|.
  Fly   492 DMPSKEERFEILRWMHVRETFNDIIYNQKAIEQLPLFSRENQSQFMPRISPSWRETLNVLQDVAA 556

Mouse   627 RCAGFVVGDLYALLTHTCRAACTRIRASGSAGGLSEEDEGDLCVAGFPLLAEDFGQALDQLQTAH 691
            :..||::|||..|..:..|.. .|.|...:...:|.                 |.:.|..:|::.
  Fly   557 KSQGFLLGDLQLLYDNAVRMK-IRNRLGRTTLDMSH-----------------FAKNLTDMQSSF 603

Mouse   692 SQAVGAPRIPSVSWHDVGGLQDVKKEILETIQLPLEHPELLSLGLRRSGLLLHGPPGTGKTLLAK 756
            :.::|||::|.|.|.|:|||..:|.||..:|.|||:|..|:...|||||:||:|||||||||:||
  Fly   604 ADSLGAPKVPKVYWSDIGGLAKLKDEIQSSIGLPLKHVHLMGKNLRRSGILLYGPPGTGKTLVAK 668

Mouse   757 AVATECSLTFLSVKGPELINMYVGQSEENVREVFARARAAAPCIIFFDELDSLAPSRGRSGDSGG 821
            ||||||:|:||||:||||:||||||||:||||||:|||:||||::|.||||||||:||.:|||||
  Fly   669 AVATECNLSFLSVQGPELLNMYVGQSEQNVREVFSRARSAAPCVLFLDELDSLAPNRGVAGDSGG 733

Mouse   822 VMDRVVSQLLAELDGL---HSTQDVFVIGATNRPDLLDPALLRPGRFDKLVFVG---ASEDRASQ 880
            ||||||||||||:||:   .:::.:|::.|||||||:|||||||||||||.:||   .:||:|: 
  Fly   734 VMDRVVSQLLAEMDGMSDGDTSKPIFILAATNRPDLIDPALLRPGRFDKLFYVGPCSTAEDKAA- 797

Mouse   881 LRVLSAITRKFKLEASVSLANVLDCCPPQLTGADLYSLCSDAMMTALKRRVRDLEEGL----ELR 941
              ||.|.|::|.|:|.|.:..:.:....:::||||||:||:|.::|::|.:.....|.    ||.
  Fly   798 --VLRAQTQRFALDAGVDMEQIAERLKSEMSGADLYSICSNAWLSAVRRTIDGHLSGTISEKELV 860

Mouse   942 SSALLLTMEDLLQAAARLQPSVSEQELLRYKRIQRKFA 979
            ...:::..||..::..:..||:|.::|..:..::..::
  Fly   861 PENVIVQEEDFTKSFNKFVPSISAKDLEYFNNLKASYS 898

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pex6NP_663463.1 SpoVK 464..968 CDD:223540 220/551 (40%)
AAA 467..596 CDD:278434 40/133 (30%)
AAA 744..872 CDD:278434 99/131 (76%)
Pex6NP_001027403.2 SpoVK 367..847 CDD:223540 208/527 (39%)
P-loop_NTPase 367..492 CDD:304359 35/144 (24%)
AAA 653..787 CDD:278434 83/140 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C332355579
eggNOG 1 0.900 E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 375 1.000 Inparanoid score I2069
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000162
OrthoInspector 1 1.000 T1082261
orthoMCL 1 0.900 OOG5_129222
Panther 1 1.100 LDO PTHR23077
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R903
TreeFam 1 0.960
109.780

Return to query results.
Submit another query.