DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: GPC4 and dally

Sequence 1:NP_001439.2 Gene:GPC4 HGNCID:4452 Length:556 Species:Homo sapiens
Sequence 2:NP_001246685.1 Gene:dally FlyBaseID:FBgn0263930 Length:626 Species:Drosophila melanogaster

Alignment Length:635 Identity:147/636 (23%)
Similarity:256/636 (40%) Gaps:107/636 (17%)


Human     1 MARFGLPALLCTLAVLSAAL---------LAAELKSKSCSEVRRLY------------------V 38
            :|:..|..|||....||||.         ....|.|.:....|||.                  |
  Fly     8 LAQLLLFTLLCGFVGLSAAKHLDLDGIHHHQHHLHSATTHHRRRLQRDSRAKDAVGGSTHQCDAV 72

Human    39 SKGFNKNDAPLHEINGDHLKICPQGSTCCSQEMEEKYSLQSKDDFKSVVSEQCNHLQAVFASRYK 103
            ...|...|........:...||  |..||:...|.:...::...|:.::....:.|:.|..:..|
  Fly    73 KSYFESIDIKSSGTYSEKGAIC--GGNCCNNATELELRDKAAGMFEQLLHHHTSSLRGVLETNAK 135

Human   104 KFDEFFKELLENAEKSLNDMFVKTYGHLYMQNSELFKDLFVELKRYYV----------------V 152
            :|.....||.:.:|...:.:|.|.|..:...:..:...|:.|:..:.:                :
  Fly   136 QFQSHVLELAQISENMTHSLFSKVYTRMVPSSRMMIHQLYTEIMNHLIYTSNYTNSNGQLGRRGI 200

Human   153 GNV--NLEEMLNDFWARLL----ERMFRL-VNSQYHFTDEYLECVSKYTEQLKPFGDVPRKLKLQ 210
            |:|  ||||.:..|:.:|.    .:|..| .|:.....::|:.|:....:::.||||:|::::..
  Fly   201 GSVQSNLEEAVRHFFVQLFPVAYHQMVHLSKNNLGDLHEDYVNCLQHNFDEMHPFGDIPQQVQSN 265

Human   211 VTRAFVAARTFAQGLAVAGDVVSKVSVV---NPTAQCTHALLKMIYCSHCRG-----LVTVKPCY 267
            :.::...:..|...|..|.:|:|:...:   ..|..|...||||.||.:|.|     ....|.||
  Fly   266 LGKSVHMSNVFMNALLQAAEVLSEADALYGEQLTDTCKLHLLKMHYCPNCNGHHSSSRSETKLCY 330

Human   268 NYCSNIMRGCLAN-QGDLDFEWNNFIDAM-LMVAERLEGPFNIESVMDPIDVKISDAIMNMQDNS 330
            .||.|:||||.|. .|.||..|:..:|:: .:|...:.....|.:|:..:....|:|||....|.
  Fly   331 GYCKNVMRGCSAEYAGLLDSPWSGVVDSLNNLVTTHILSDTGIINVIKHLQTYFSEAIMAAMHNG 395

Human   331 VQVSQKVFQGCGPPKPLPAGRISRSISESAFSARFRPHHPEERPTTAAGTSLDRLVTDVKEKLKQ 395
            .::.:||.:.||.|...|       .|.....||..||....:..|.....:...::.:    .:
  Fly   396 PELEKKVKKTCGTPSLTP-------YSSGEPDARPPPHKNNVKWATDPDPGMVLFLSTI----DK 449

Human   396 AKKFWSSLPSNVCNDERMAAGNGNEDDCWNGKGKSRYLFAVTGNGLANQGNNPEV----QVDTSK 456
            :|:|::::..|.|::::.:.   ::..||:|.....|...:...|..:|..||||    :..|.|
  Fly   450 SKEFYTTIVDNFCDEQQHSR---DDHSCWSGDRFGDYTQLLINPGTDSQRYNPEVPFNAKAQTGK 511

Human   457 PDILI-----LRQ----------IMALRVMTSKMKNAYNGNDVDFFDISDE-----SSGEGSGSG 501
            .:.|:     :|:          |.|...:.:.|.....|.:....|..:|     .||:|||.|
  Fly   512 LNELVDKLFKIRKSIGAAAPSNSIQATHDIQNDMGEGSGGGEGQIGDDEEEYGGAHGSGDGSGDG 576

Human   502 CEYQQCPSEFDYNATDHAGKSANEKADSAGVRP--GAQAY-LLTVFCILF 548
               ...|.|.....|.:..:| .:...::|..|  |...: |||:..:||
  Fly   577 ---PHTPIEESEGTTTNEVES-RDSGKTSGSNPLEGTATWMLLTLVTMLF 622

Known Domains:


GeneSequenceDomainRegion External IDIdentity
GPC4NP_001439.2 Glypican 26..551 CDD:307347 137/602 (23%)
dallyNP_001246685.1 Glypican 51..622 CDD:279494 134/591 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3821
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.