DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Wbp2 and Wbp2

Sequence 1:NP_058548.1 Gene:Wbp2 MGIID:104709 Length:261 Species:Mus musculus
Sequence 2:NP_648607.3 Gene:Wbp2 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster

Alignment Length:391 Identity:127/392 (32%)
Similarity:157/392 (40%) Gaps:141/392 (36%)


Mouse     1 MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLS-KGK 64
            |::|..|: ..||:::..|.||:..|.|.:.|:...|  ..|||:|.|.:|||.:|:||.| |..
  Fly     1 MSVNTAHA-NNGVLIHAGEYILLHSDSVSMEFSGQDN--PIFKGSKGGRIYLTSHRMIFNSKKSS 62

Mouse    65 DAMQSFMMPFYLMKDCEIKQPVFGANFIKGIVKAEAGGGWEGSASYKLTFTAGGAIEFGQRMLQV 129
            |:||||..||..:.|.||:|||||||:|||.|:|:..|.:.|...:||.|.||||||:||.:|:.
  Fly    63 DSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQALLRS 127

Mouse   130 ASQASRGEVPNGAYG---YPYMPSGAYVFPPPVANGMYPCPPGY------------PYP------ 173
            |..|.......|..|   .||.|:|::...||.|   |..||||            |.|      
  Fly   128 AKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPA---YQPPPGYYGWLPQHDAFSGPAPNTVYMS 189

Mouse   174 --PPPPEFYPG-----------------------------PPMMD----------GAMGYVQPPP 197
              |||   |||                             ||...          .|.|||||||
  Fly   190 DNPPP---YPGIAPPAHQPAPQQPQAPSSNEPNWYGFSAPPPQQQQQQPGYGPQGWAGGYVQPPP 251

Mouse   198 -----------PPY-------------------------PGPMEP---PVSGPSAPATPAAEA-- 221
                       |||                         ||..:|   |...|..|..|..:|  
  Fly   252 YASCAPNCPPQPPYAAPAQTYNGPQPYGGYGNVPGGFNTPGFQQPNGNPNGYPGGPPPPGQQAAG 316

Mouse   222 ----------------------KAAEAAASAY---YNPGNPH---NVYMPTSQPPPPPYYPPEDK 258
                                  |.||||||||   ||.|.|.   |..:|.|....||.|....|
  Fly   317 AAGGAAASGASFMGFSLPPGNSKEAEAAASAYNTPYNQGGPSGSGNNDLPPSYNNLPPSYDDASK 381

Mouse   259 K 259
            |
  Fly   382 K 382

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Wbp2NP_058548.1 PH-GRAM_WBP2 30..131 CDD:275401 52/102 (51%)
PPxY motif 1 196..200 4/15 (27%)
PPxY motif 2 248..252 2/4 (50%)
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 52/103 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C248144485
eggNOG 1 0.900 E1_KOG3294
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 149 1.000 Inparanoid score I4349
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001789
OrthoInspector 1 1.000 T616893
orthoMCL 1 0.900 OOG5_132815
Panther 1 1.100 LDO PTHR31606
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1809
TreeFam 1 0.960
1211.790

Return to query results.
Submit another query.