DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Uxt and Uxt

DIOPT Version :9

Sequence 1:NP_038868.2 Gene:Uxt / 22294 MGIID:1277988 Length:157 Species:Mus musculus
Sequence 2:NP_001260464.1 Gene:Uxt / 34893 FlyBaseID:FBgn0259982 Length:162 Species:Drosophila melanogaster


Alignment Length:130 Identity:39/130 - (30%)
Similarity:75/130 - (57%) Gaps:2/130 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse    16 KVLRYETFISDVLQRDLQKVLDHRDKVYEQLSVYLQLRNVIERLQETNHSELY-MQVDLGCNFFV 79
            ::.:.|.||::||:.||:::.....:..|::..|:||:|.::.. :|:..:.| .||::|.|.|:
  Fly    23 RITQIEEFINEVLKEDLRELEKCIGQYNEEIMEYVQLKNTLQTF-DTHLPDGYKTQVNIGSNVFM 86

Mouse    80 DTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSDSLTKDSMNIKAHIHMMLEGLRE 144
            ...|.....|.|.:|...||::::.:|.:|.|.:..:||:.||.|..:|:..:|.|.|.|..:.|
  Fly    87 QARVRKMDSILVDVGKNVFLDMSIPDAERFCDTRVKILTKQSDVLRDESVKKRAQIKMALIAISE 151

Mouse   145  144
              Fly   152  151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UxtNP_038868.2 Prefoldin_alpha 18..147 CDD:238327 39/128 (30%)
UxtNP_001260464.1 Prefoldin_alpha 26..154 CDD:238327 39/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I11012
eggNOG 1 0.900 - - E1_KOG3047
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5348
Isobase 1 0.950 - 0 Normalized mean entropy S6280
OMA 1 1.010 - - QHG54805
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005437
OrthoInspector 1 1.000 - - oto94171
orthoMCL 1 0.900 - - OOG6_103935
Panther 1 1.100 - - LDO PTHR13345
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5483
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.810

Return to query results.
Submit another query.