DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uxt and Uxt

Sequence 1:NP_038868.2 Gene:Uxt MGIID:1277988 Length:157 Species:Mus musculus
Sequence 2:NP_001260464.1 Gene:Uxt FlyBaseID:FBgn0259982 Length:162 Species:Drosophila melanogaster

Alignment Length:130 Identity:39/131 (30%)
Similarity:75/131 (57%) Gaps:2/131 (2%)


Mouse    16 KVLRYETFISDVLQRDLQKVLDHRDKVYEQLSVYLQLRNVIERLQETNHSELY-MQVDLGCNFFV 79
            ::.:.|.||::||:.||:::.....:..|::..|:||:|.::.. :|:..:.| .||::|.|.|:
  Fly    23 RITQIEEFINEVLKEDLRELEKCIGQYNEEIMEYVQLKNTLQTF-DTHLPDGYKTQVNIGSNVFM 86

Mouse    80 DTVVPDTSRIYVALGYGFFLELTLAEALKFIDRKSSLLTELSDSLTKDSMNIKAHIHMMLEGLRE 144
            ...|.....|.|.:|...||::::.:|.:|.|.:..:||:.||.|..:|:..:|.|.|.|..:.|
  Fly    87 QARVRKMDSILVDVGKNVFLDMSIPDAERFCDTRVKILTKQSDVLRDESVKKRAQIKMALIAISE 151

Mouse   145  144
              Fly   152  151

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UxtNP_038868.2 Prefoldin_alpha 18..147 CDD:238327 39/129 (30%)
UxtNP_001260464.1 Prefoldin_alpha 26..154 CDD:238327 39/128 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3047
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5311
Isobase 1 0.950 0 Normalized mean entropy S6280
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006103
OrthoInspector 1 1.000 T1084373
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13345
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5483
TreeFam 1 0.960
1110.910

Return to query results.
Submit another query.