DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Usp9x and faf

Sequence 1:XP_006527649.1 Gene:Usp9x MGIID:894681 Length:2575 Species:Mus musculus
Sequence 2:NP_524612.2 Gene:faf FlyBaseID:FBgn0005632 Length:2778 Species:Drosophila melanogaster

Alignment Length:2662 Identity:1258/2663 (47%)
Similarity:1694/2663 (64%) Gaps:247/2663 (9%)


Mouse     2 TATTRGSP---VGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGD-------- 55
            |.||..||   .|.....|......:...|....:.|.|.:.:..|||  |.|...|        
  Fly    27 TTTTTTSPAQSAGSGSGIGTGTGTVANSSLPGGGSGSLDGNQDQQPAT--DSQSSDDVAASLSAN 89

Mouse    56 --------APPQIEDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVK 112
                    .||  |....:||.|.|..|...|:.|||||||||:.||||||.|||:|::.|:|..
  Fly    90 SVDSTITIVPP--EKLISSFPTTKLRSLTQKISNPRWVVPVLPEQELEVLLNAAIELTQAGVDHD 152

Mouse   113 SEACQRFFRDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLAQDWFPLLELLAMA 177
            .|.|..|:|:||:.||.||||||||:.||..||.||:.:..:|:.|....:.:|...||:|||:.
  Fly   153 CEPCVEFYRNGLSTSFAKILTDEAVNSWKNNIHHCILVSCGKLLHLIAIHMQRDNPYLLDLLAIV 217

Mouse   178 LNPHCKFHIYN-GTRP-CESVSSSV--QLPEDELFAR-SPDPRSPKGWLVDLLNKFGTLNGFQIL 237
            .:|..||:.:| |.:| |.:....:  ||..::::|| .|:|::.:||||||:|:||.|.||..|
  Fly   218 FDPENKFNTFNAGRQPECFAAPDYIWGQLDSNKMYARPPPEPKNARGWLVDLINRFGQLGGFDNL 282

Mouse   238 HDRFING----------------------------SALNVQIIAALIKPFGQCYEFLTLHTVKKY 274
            .:||..|                            :.|.:.:|.:|::|||||||.|...|:.||
  Fly   283 LERFNIGLELLKRNQNKCTGKNISVEGRVENGAQDNRLTLALIHSLLRPFGQCYELLMPATIAKY 347

Mouse   275 FLPIIEMVPQFLENLTDEELKKEAKNEAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMI 339
            |:|...:|...|::.||||||:|.|.|.:||.::.|:||.:.||||:.||||.:::||:||||||
  Fly   348 FMPTWNVVLDLLDSFTDEELKREVKPEGRNDYINGIVKSARLLASRLTGQEELIRDLEMFRLKMI 412

Mouse   340 LRLLQISSFNGKMNALNEVNKVISSVSYYTHR-----HGSSEDE-EWLTAERMAEWIQQNNILSI 398
            |||||:||||||||||||:|||:|||:|::||     |...||| :||||:|||:||:.:::|.:
  Fly   413 LRLLQVSSFNGKMNALNEINKVLSSVAYFSHRSQPLPHCMPEDEMDWLTADRMAQWIKSSDVLGV 477

Mouse   399 VLRDSLHQPQYVEKLEKILRFVIKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPE 463
            ||:|||||||||||||||:||:|||:||||.|||.:|.||||||||||||||||||||||||:||
  Fly   478 VLKDSLHQPQYVEKLEKIIRFLIKEQALTLDDLDAVWRAQAGKHEAIVKNVHDLLAKLAWDFTPE 542

Mouse   464 QLDHLFDCFKASWTNASKKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDLA 528
            ||||||:.|:||.|.|:|:|||:|||||||||||||:||||.|||.|.|.||||.:||.:::|.|
  Fly   543 QLDHLFEAFQASMTTANKRQRERLLELIRRLAEDDKNGVMAQKVLKLFWTLAHSQEVPPEVLDQA 607

Mouse   529 LSAHIKILDYSCSQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSSSRFS 593
            |.||:|||||||||:||.||..|:|:.::||::.|.||:|||:.||:||.|:        .:..:
  Fly   608 LGAHVKILDYSCSQERDAQKTIWLDKCVDELKSGDGWVLPALRLIRDICCLY--------DTTTN 664

Mouse   594 QSQRSPHVFYRHDLINQLQHNHALVTLVAENLATYMESMRMYGRDNEDYDPQTVRLGSRYSHVQE 658
            .:||:.....|..:|.:||::::||.||..:|..|||.:|....|:...|...:.:..|:.|..:
  Fly   665 HAQRTQTSTNRQQVIERLQNDYSLVILVTNSLTAYMEKVRQMVTDSPGLDATRILIDGRFPHHVQ 729

Mouse   659 VQERLNFLRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKD 723
            :.|||.||:||||||||||||.||||||.|||.|||:..|||.||:|:.||||:||||||.||||
  Fly   730 IAERLEFLKFLLKDGQLWLCADQAKQIWHCLAVNAVFPADREECFRWFGKLMGEEPDLDPGINKD 794

Mouse   724 FFESNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQSND 788
            |||:|:|||||.||||:|:|||||||||||.:|.||.|..|.||:|:.:|||.||||||:....:
  Fly   795 FFENNILQLDPHLLTESGIKCFERFFKAVNSKEDKLKAIHRGYMLDNEDLIGKDYLWRVITTGGE 859

Mouse   789 DIACRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVL--------------- 838
            :||.:|||||||:.|.||||||.|....||.||..|..||:..|..:.:|               
  Fly   860 EIASKAIDLLKEVSTALGPRLQENIAEFHEMFIGECCSRLRTHYGNIVILGKTQLQEELDAPDQS 924

Mouse   839 ----DGDKDSINCARQEAVRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHLSFIVRFPN 899
                |..||| .....||.:|.|:|.||:||:.|||..:..:|..||:||..|||:....:||.|
  Fly   925 DNTNDESKDS-KMRFIEAEKMCRILKVLQEYVKECDRSFSGDRVHLPLSRVTRGKNTILYIRFQN 988

Mouse   900 QGRQVDDLEVWSHTNDTIGSVRRCILNRIK-ANVAHTKIELF-VGGELIDPGDDRKLIGQLNLKD 962
            .||.:||:|:.:|:|:|:.:.:|.:|.||| .:.|:.|::|| ...|:|...|:...:.|..::|
  Fly   989 PGRSIDDMEIVTHSNETMAAFKRNLLKRIKGTSTANIKVDLFYANDEMIGVSDEINPLYQYTIRD 1053

Mouse   963 KSLITAKLTQISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNP-------EVESCLPGVIMSLHP 1020
            |..:|||||.:.:.:.||||||||||||||          |.|       |.||.|||||:|.:.
  Fly  1054 KMNLTAKLTPVGTGLASSPDSSSDSSTGSP----------PRPCPDMQRVESESTLPGVIISQNY 1108

Mouse  1021 RYISFLWQVADLGSSLNMPPLRDGARVLMKLMPPDSTTIEKLRAICL-------------DHAKL 1072
            :|..|..::..|||.|....|||.|:||:.|:|.|..||.:|:.:|.             ..||.
  Fly  1109 QYTEFFLKLYQLGSDLEHGRLRDSAKVLLHLLPCDRQTIRQLKIMCKVPKAAVTVAVTGDKIAKD 1173

Mouse  1073 GESSLSP-------------SLDSLFFGPSASQVLYLTEVVYALLMPAGAPLTDDSSDFQFHFLK 1124
            .|..|.|             :.:.:|..|:.:||||...|::.||:||..||.:.:...|..::.
  Fly  1174 EEEKLYPTEQAGIEDEEEHCTPEQMFLHPTPAQVLYNLSVLHGLLIPALDPLGESALLVQSAWMH 1238

Mouse  1125 SGGLPLVLSMLTRNNFLPNADMETRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPGVEGVNPM 1189
            ||....||.:||:|||||:|||.|:|.::...|::|||.|..:|....|.          |..||
  Fly  1239 SGCAHFVLELLTKNNFLPSADMHTKRASFQCVLRLAKLFLYIVGSVLSRV----------GDEPM 1293

Mouse  1190 -TSVNQVTHDQAVVLQSALQSIPNPSSECMLRNVSVRLA-------QQISDEASR---------- 1236
             ..::..:..|..:|:....::|: ||:..||.:|.:||       ...|.|..|          
  Fly  1294 ICDLDNGSRSQVDILKQNFSTMPS-SSQGTLRAISAKLAVILAREMLSASPEGDRCRTLFSSTLQ 1357

Mouse  1237 -YMPDICVIRAIQKIIWTSGCGGLQLVFSPN----EEVTKIYEKTNAGNEPDLEDEQVCCEALEV 1296
             ..|||..|:|:.::.|.|.||.||.:.:.:    :||.          .||.:|..:|.|||||
  Fly  1358 WSCPDISTIKAVVQLAWASSCGNLQALGNSSGDFEDEVI----------VPDGQDFSMCKEALEV 1412

Mouse  1297 MTLCFALIPTALDALSKEKAWQTFIIDLLLHCHSKTVRQVAQEQFFLMCTRCCMGHRPLLFFITL 1361
            :|:.|.|.|:|.:||:.:..|..||..::|....:.|||||.||.||..|.|....||.::.:.|
  Fly  1413 LTISFILNPSANEALTSDPNWPKFITSIVLKNPLRHVRQVASEQLFLASTYCAGDRRPFVYMVNL 1477

Mouse  1362 LFTVLGSTARERAKHSGDYFTLLRHLLNYA--YNSNINVPNAEVLLNNEIDWLKRIRDDVKRTGE 1424
            |...|.:...:......::|::|...|:|.  ||..:.:  :|.||.:||.||:|||::|..||:
  Fly  1478 LVGALKTLVPQYESTCAEFFSVLCRTLSYGCIYNWPLQI--SEGLLGDEIKWLQRIRENVHATGD 1540

Mouse  1425 TGVEETILEGHLGVTKELLAFQTPEKKFHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELP 1489
            |.|.|.:|||||.:.|||:.|...:.|..:.      .||.||||||:|.||..:|...|:|.|.
  Fly  1541 TQVHEELLEGHLCLAKELMFFLGADSKAQLN------ELIHELIDDFLFTASREFLHLRRHGSLR 1599

Mouse  1490 AEQA-IPVCGSPATINAGFELLVALAVGCVRNLKQIVDSLTEMYYIGTAITTCEALTEWEYLPPV 1553
            .:.. .|||.||.||.|..:||:||...||.|:|.:.::|     |....|..:.|.||:|||||
  Fly  1600 QDTVPPPVCRSPHTIAAACDLLIALCQLCVPNMKLLTNTL-----IDFVCTDTDPLREWDYLPPV 1659

Mouse  1554 GPRPPKGFVGLKNAGATCYMNSVIQQLYMIPSIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDP 1618
            |.||.|||.||||||||||||||:|||||:|::|.|||...|..:...:|.|||   .:.:....
  Fly  1660 GARPTKGFCGLKNAGATCYMNSVLQQLYMVPAVRVGILRAHGAATTDGEDFSGD---SDLTGGGL 1721

Mouse  1619 RDDVFGYP-QQFEDKPPLSKT-ED-----RKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQF 1676
            ...:|..| ......|..|.| ||     ||.|::.:|:|:|.||.||..|.||||||||.|..|
  Fly  1722 GSALFSGPASALVSLPSSSSTIEDGLHDVRKNYHVVILKHVQAIFAHLGHSALQYYVPRGLWTHF 1786

Mouse  1677 RLWGEPVNLREQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEES 1741
            :|.|||||||||.||:|||.||::||||.|||||.|.:::..|||||:||||||.|||||..||.
  Fly  1787 KLLGEPVNLREQQDAVEFFMSLLESLDEGLKALGQPQLMNATLGGSFSDQKICQECPHRYSKEEP 1851

Mouse  1742 FTTLNVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFD 1806
            |:..:||||||.:|.:||||||||:|||||:||||:||:|||.||||:.:||||||||||||||:
  Fly  1852 FSVFSVDIRNHSSLTESLEQYVKGELLEGADAYHCDKCDKKVVTVKRVCVKKLPPVLAIQLKRFE 1916

Mouse  1807 YDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDNVNPESQLIQQNEQSESEKAGSTKYRLV 1871
            ||:||.|||||||||||||.||||||||:|:|||||:.|.     :..|.|:..|   :|||.|.
  Fly  1917 YDYERVCAIKFNDYFEFPRILDMEPYTVSGLAKLEGEVVE-----VGDNCQTNVE---TTKYELT 1973

Mouse  1872 GVLVHSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVFD 1936
            |::|||||||||||:|||:.:|..:| |.:|||||||:||||||.:|||||.:|||||||||.:|
  Fly  1974 GIVVHSGQASGGHYFSYILSKNPANG-KCQWYKFDDGEVTECKMHEDEEMKAECFGGEYMGETYD 2037

Mouse  1937 HMMKRMSYRRQKRWWNAYILFYERMDTIGHDDEVIRY---ISEIAITTRPHQIV-MPSAIERSVR 1997
            :.:|||.|||||||||||:|||.|.     |...::|   :.::::....:.:: :|..||||||
  Fly  2038 NNLKRMQYRRQKRWWNAYMLFYTRC-----DQTPVQYEPSVEQLSLAESRNMVLPLPKPIERSVR 2097

Mouse  1998 KQNVQFMHNRMQYSLEYFQFMKKLLTCNGVYLNPPPGQDHLSPEAEEITMISIQLAARFLFTTGF 2062
            .||::|:|:|..:|:|:|.|:|||::||.:...    .:.::|.|||::::.:|||::|||.|||
  Fly  2098 HQNIRFLHSRSIFSVEFFNFIKKLVSCNLLSAR----SNKITPAAEELSLLGVQLASQFLFHTGF 2158

Mouse  2063 HTKKIVRGSASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRFSEYLLECPSAEVRGAFAKLIVF 2127
            .|||.:||...:|||||...:|.|..||.|||::.|.:..:|..||:|..||.:||..|.||:||
  Fly  2159 RTKKSLRGPVMEWYDALSHHIRSSALVRKWFANHALLSPPSRLGEYILMAPSPDVRTVFVKLVVF 2223

Mouse  2128 IAHFSLQDGPCPSPFASPGPSSQAYDNLSLSDHLLRAVLNLLRREVSEHGRHLQQYFNLFVMYAN 2192
            ..||::.|.|.           ..||..:|.:.:|.:||.||:.|.:::|:||..||:||.||..
  Fly  2224 FCHFAINDEPL-----------TGYDGANLCEQVLISVLRLLKSEAADYGKHLPHYFSLFSMYVG 2277

Mouse  2193 LGVAEKTQLLKLSVPATFMLVSLDEGPGPPIKYQYAELGKLYSVVSQLIRCCNVSSRMQSSINGN 2257
            ||..||.|||:|:||..|:.|:||:||||.|||||.|..||:.|||.||||.:||.:.|||....
  Fly  2278 LGTREKQQLLRLNVPLQFIQVALDDGPGPAIKYQYPEFSKLHQVVSHLIRCSDVSEKCQSSNQNA 2342

Mouse  2258 PSLPNPFGDPNLS-QPIMPIQQNVVDILFVRTSYVKKIIEDCSNSDETVKLLRFCCWENPQFSST 2321
            ..|.|||.|||:: :.:.|:....:|:||.||.|:||:|||.:..||.:|||::|.||||.||..
  Fly  2343 RPLSNPFKDPNVAHEELTPLSTECMDLLFNRTGYIKKVIEDTNVGDEGLKLLQYCSWENPHFSRA 2407

Mouse  2322 VLSELLWQVAYSYTYELRPYLDLLLQILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQ 2386
            ||:|||||..::|.:::|.:.||||.||||:||||.|||||||.|:.::|:||.:||||:|.|||
  Fly  2408 VLTELLWQCGFAYCHDMRHHTDLLLNILLIDDSWQHHRIHNALNGVAEEREGLLETIQRAKTHYQ 2472

Mouse  2387 KRAYQCIKCMVALFSSCPVAYQILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPV 2451
            |||||.|||:..||...|:|.|:|..|.::.|.|:.|||||..||:|:...| .||...:||||.
  Fly  2473 KRAYQIIKCLTQLFHKSPIALQMLHTNSNITRHWSIAVEWLQGELDRQRGIG-CQYNSYSWSPPA 2536

Mouse  2452 QSNETSNGYFLERSHSARMTLAKACELCPEEVKKATSLQEIEMEESKEPDDQDAPDEHESPP 2513
            |||:.:|||.||||.||:.|.:.|.||||:||.:.|       :|:.||:.:...||::|.|
  Fly  2537 QSNDNTNGYMLERSQSAKNTWSMAFELCPDEVSEKT-------DENNEPNLETNMDENKSEP 2591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Usp9xXP_006527649.1 peptidase_C19C 1560..1963 CDD:239124 255/410 (62%)
UCH 1562..1958 CDD:278850 251/403 (62%)
fafNP_524612.2 peptidase_C19C 1666..2064 CDD:239124 256/415 (62%)
UCH 1668..2059 CDD:278850 251/403 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5077
Hieranoid 1 1.000
Homologene 1 1.000 H3418
Inparanoid 1 1.050 2269 1.000 Inparanoid score I37
Isobase 1 0.950 0 Normalized mean entropy S4546
OMA 1 1.010
OrthoDB 1 1.010 D22076at33208
OrthoFinder 1 1.000 FOG0001696
OrthoInspector 1 1.000 T615791
orthoMCL 1 0.900 OOG5_130114
Panther 1 1.100 LDO PTHR24006
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4564
TreeFam 1 0.960
1413.820

Return to query results.
Submit another query.