DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ugdh and sgl

Sequence 1:NP_033492.1 Gene:Ugdh MGIID:1306785 Length:493 Species:Mus musculus
Sequence 2:NP_476980.1 Gene:sgl FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster

Alignment Length:476 Identity:319/477 (67%)
Similarity:389/477 (82%) Gaps:3/477 (1%)


Mouse     6 KICCIGAGYVGGPTCSVIAHMCPEIRVTVVDVNEARINAWNSPTLPIYEPGLKEVVESCRGKNLF 70
            |:|||||||||||||:|:|..||:|.:|:||.:..||..|||..||||||||.|||:.||..|||
  Fly     2 KVCCIGAGYVGGPTCAVMALKCPDIVITLVDKSSERIAQWNSDKLPIYEPGLDEVVKKCRNVNLF 66

Mouse    71 FSTNIDDAIREADLVFISVNTPTKTYGMGKGRAADLKYIEACARRIVQNSNGYKIVTEKSTVPVR 135
            |||:|:.||:||||:||||||||||.|.||||||||||:|:.||.|.:.:...|||.||||||||
  Fly    67 FSTDIETAIKEADLIFISVNTPTKTCGNGKGRAADLKYVESAARMIAEIAQSNKIVVEKSTVPVR 131

Mouse   136 AAESIRRIFDANTKPNLNLQVLSNPEFLAEGTAIKDLKNPDRVLIGGDETPEGQKAVRALCAVYE 200
            |||||..|..||.||.::..:|||||||||||||.||.|.|||||||:|||||.:||..|..:||
  Fly   132 AAESIMHILRANQKPGIHYDILSNPEFLAEGTAINDLLNADRVLIGGEETPEGHQAVEKLSWIYE 196

Mouse   201 HWVPKEKILTTNTWSSELSKLAANAFLAQRISSINSISALCEATGADVEEVATAIGMDQRIGNKF 265
            ||:||:.|||||||||||||||||||||||||||||:||:||||||||.|||.|:|:|.|||:||
  Fly   197 HWIPKQNILTTNTWSSELSKLAANAFLAQRISSINSLSAVCEATGADVSEVARAVGLDSRIGSKF 261

Mouse   266 LKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQQVIDMNDYQRRRFASRIIDSLFNTVTDKK 330
            |:|||||||||||||:|||:|:||.|||||||.|||||||||:||:|||:.:||:||||||:||:
  Fly   262 LQASVGFGGSCFQKDILNLIYICENLNLPEVAAYWQQVIDMNEYQKRRFSQKIIESLFNTVSDKR 326

Mouse   331 IAILGFAFKKDTGDTRESSSIYISKYLMDEGAHLHIYDPKVPREQIVVDLSHPGVS-ADDQVSRL 394
            ||||||||||:||||||:::|.:.:.|::|||.|.||||||..|||:.||:||.|: :.::|.:.
  Fly   327 IAILGFAFKKNTGDTRETAAITVCQTLLEEGAALDIYDPKVEPEQIIDDLTHPSVTESPEKVKKA 391

Mouse   395 VTISKDPYEACDGAHALVICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHSELQTIGFQI 459
            |.|..|||.|....||||||||||.|.:||::||::.|:|||:|||||::||  |..||.|||.:
  Fly   392 VQIHSDPYSAVRATHALVICTEWDEFVDLDFKRIYQSMMKPAYIFDGRKILD--HERLQQIGFHV 454

Mouse   460 ETIGKKVSSKRIPYTPGEIPK 480
            :|||||.....:..:.|.:|:
  Fly   455 QTIGK
KYQRTGLLRSWGIVPQ 475

Known Domains:


GeneSequenceDomainRegion External IDIdentity
UgdhNP_033492.1 PLN02353 4..464 CDD:177986 315/459 (69%)
Intrinsically disordered, important for formation of active hexamer structure. {ECO:0000250|UniProtKB:O60701} 88..110 19/22 (86%)
Allosteric switch region. {ECO:0000250|UniProtKB:O60701} 129..135 6/6 (100%)
Substrate binding. {ECO:0000250|UniProtKB:O60701} 161..165 4/4 (100%)
Substrate binding. {ECO:0000250|UniProtKB:O60701} 220..224 4/4 (100%)
Substrate binding. {ECO:0000250|UniProtKB:O60701} 267..273 5/6 (83%)
Important for formation of active hexamer structure. {ECO:0000250|UniProtKB:O60701} 321..325 4/4 (100%)
Substrate binding. {ECO:0000250|UniProtKB:O60701} 338..339 1/1 (100%)
Intrinsically disordered. {ECO:0000250|UniProtKB:O60701} 466..493 2/16 (13%)
sglNP_476980.1 PLN02353 1..459 CDD:177986 315/459 (69%)
UDPG_MGDP_dh_N 2..189 CDD:281683 129/187 (69%)
UDPG_MGDP_dh 210..305 CDD:279344 80/95 (84%)
UDPG_MGDP_dh_C 328..444 CDD:281682 68/118 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C287649159
eggNOG 1 0.900 E1_COG1004
Hieranoid 1 1.000
Homologene 1 1.000 H2520
Inparanoid 1 1.050 653 1.000 Inparanoid score I771
Isobase 1 0.950 0 Normalized mean entropy S2080
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005011
OrthoInspector 1 1.000 T1082515
orthoMCL 1 0.900 OOG5_126979
Panther 1 1.100 O PTHR11374
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1312.710

Return to query results.
Submit another query.