| Sequence 1: | NP_035801.3 | Gene: | Ucp2 / 22228 | MGIID: | 109354 | Length: | 309 | Species: | Mus musculus |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001260966.1 | Gene: | CG18327 / 36567 | FlyBaseID: | FBgn0033904 | Length: | 304 | Species: | Drosophila melanogaster |
| Alignment Length: | 298 | Identity: | 91/298 - (30%) |
|---|---|---|---|
| Similarity: | 142/298 - (47%) | Gaps: | 22/298 - (7%) |
- Green bases have known domain annotations that are detailed below.
|
Mouse 13 ATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGLVRTAASAQ-YRGVLGTILTMVRTEGPR 76
Mouse 77 SLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHAGIGSRLLA-GSTTGALAVAV----AQP 136
Mouse 137 TDVVKVRFQAQA----RAGGGRRYQSTVEAYKTIAREEGIRGLWKGTSPNVARNAIVNCAELVTY 197
Mouse 198 DLIKDTLLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKTRYMNSAL-----GQYHSAG-HC 256
Mouse 257 ALTMLRKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQL 294 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ucp2 | NP_035801.3 | Mito_carr | 11..109 | CDD:365909 | 30/96 (31%) |
| Solcar 1 | 11..106 | 30/93 (32%) | |||
| Solcar 2 | 114..203 | 28/97 (29%) | |||
| Mito_carr | 115..206 | CDD:365909 | 29/99 (29%) | ||
| Solcar 3 | 212..297 | 28/89 (31%) | |||
| Mito_carr | 217..299 | CDD:365909 | 28/84 (33%) | ||
| Purine nucleotide binding. /evidence=ECO:0000250 | 276..298 | 3/19 (16%) | |||
| CG18327 | NP_001260966.1 | Mito_carr | 4..87 | CDD:278578 | 27/85 (32%) |
| PTZ00169 | 5..293 | CDD:240302 | 88/293 (30%) | ||
| Mito_carr | 101..201 | CDD:278578 | 29/99 (29%) | ||
| Mito_carr | 204..296 | CDD:278578 | 29/90 (32%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||