DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ucp1 and CG1907

Sequence 1:NP_033489.1 Gene:Ucp1 MGIID:98894 Length:307 Species:Mus musculus
Sequence 2:NP_651703.1 Gene:CG1907 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster

Alignment Length:289 Identity:87/290 (30%)
Similarity:144/290 (50%) Gaps:8/290 (3%)


Mouse    12 TMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYS 76
            |..:|....|:|...|.::..|||..|.|:||.|.|  |....|:..|..|.|:...||...||.
  Fly    16 TNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAG--SGKKEYRSSLHCIQTIVSKEGPLALYQ 78

Mouse    77 GLPAGIQRQISFASLRIGLYDSVQEYFSSGRETPASLGNKISAGLMTGGVAVFIGQPTEVVKVRM 141
            |:.|.:.||.::.:.|:|:|..:.:.|....:....:.:.::.|.:.|....|||.|.||..|||
  Fly    79 GIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDSMAMGTIAGACGAFIGTPAEVALVRM 143

Mouse   142 QAQSHLHGIKPR-YTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNN 205
            .:...|...:.| ||...||...|...|.|:.||:|:.|.:.|.:::|.|:|.:|...|....:.
  Fly   144 TSDGRLPVAERRNYTNVANALARITREEGLTALWRGSLPTVGRAMVVNMTQLASYSQFKTYFRHG 208

Mouse   206 KI-LADDVPCHLLSALVAGFCTTLLASPVDVVKTRFIN--SLPG--QYPSVPSCAMSMYTKEGPT 265
            .: :.:.:..|..:::::|..||:.:.|:|:.|||..|  .:.|  :|.......:.:..:||..
  Fly   209 PLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKMVDGKPEYRGTADVLLRVARQEGVF 273

Mouse   266 AFFKGFVASFLRLGSWNVIMFVCFEQLKK 294
            |.:|||...:.|||...|:.|:..|||.:
  Fly   274 ALWKGFTPYYCRLGPHTVLTFIILEQLNQ 302

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ucp1NP_033489.1 Mito_carr 10..103 CDD:278578 30/91 (33%)
Solcar 1 11..102 30/90 (33%)
PTZ00169 21..297 CDD:240302 85/281 (30%)
Mito_carr 110..206 CDD:278578 30/97 (31%)
Solcar 2 111..201 30/91 (33%)
Solcar 3 210..295 26/90 (29%)
Mito_carr 215..300 CDD:278578 26/85 (31%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 31/95 (33%)
Mito_carr 118..207 CDD:278578 30/89 (34%)
Mito_carr 219..307 CDD:278578 26/85 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.