DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Uchl1 and Uch

Sequence 1:NP_035800.2 Gene:Uchl1 MGIID:103149 Length:223 Species:Mus musculus
Sequence 2:NP_001188681.1 Gene:Uch FlyBaseID:FBgn0010288 Length:227 Species:Drosophila melanogaster

Alignment Length:222 Identity:102/223 (46%)
Similarity:150/223 (67%) Gaps:6/223 (3%)


Mouse     5 PMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSPACALLLLFPLTAQHENFRKKQIEE 69
            |:|.|||:|.|.:.||||:..|...||:|||::||..:|.|..|.:||||.:..:|..|.::.:.
  Fly     6 PLESNPEVLTKYIHKLGVSPAWSVTDVIGLEDDTLEWIPRPVKAFILLFPCSETYEKHRAEEHDR 70

Mouse    70 LKG-QEVSPK-VYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSETEKLSPEDRAKC 132
            :|. :|..|: :::|:|...|:|||:.|||:||||:: ::.:.| |||.||.:|..||||:|.:.
  Fly    71 IKEVEEQHPEDLFYMRQFTHNACGTVALIHSVANNKE-VDIDRG-VLKDFLEKTASLSPEERGRA 133

Mouse   133 FEKNEAIQAAHDSVAQEGQCRV--DDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDSLLQ 195
            .||:|...|.|:::|||||...  .:||..|||...|.:|.|||||||..||:.||.:||::.::
  Fly   134 LEKDEKFTADHEALAQEGQTNAANHEKVIHHFIALVNKEGTLYELDGRKSFPIKHGPTSEETFVK 198

Mouse   196 DAAKVCREFTEREQGEVRFSAVALCKA 222
            ||||||:||..|:..||||:.:||..|
  Fly   199 DAAKVCKEFMARDPNEVRFTVLALTAA 225

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Uchl1NP_035800.2 Peptidase_C12_UCH_L1_L3 5..219 CDD:187737 100/218 (46%)
Interaction with ubiquitin. {ECO:0000250|UniProtKB:P09936} 5..10 3/5 (60%)
Interaction with ubiquitin. {ECO:0000250|UniProtKB:P09936} 211..216 4/5 (80%)
UchNP_001188681.1 Peptidase_C12_UCH_L1_L3 4..222 CDD:187737 100/218 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1415
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3426
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001181
OrthoInspector 1 1.000 T615714
orthoMCL 1 0.900 OOG5_127717
Panther 1 1.100 O PTHR10589
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1588
TreeFam 1 0.960
1110.860

Return to query results.
Submit another query.