DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tshr and rk

Sequence 1:NP_035778.3 Gene:Tshr MGIID:98849 Length:764 Species:Mus musculus
Sequence 2:NP_476702.1 Gene:rk FlyBaseID:FBgn0003255 Length:1360 Species:Drosophila melanogaster

Alignment Length:725 Identity:233/726 (32%)
Similarity:349/726 (48%) Gaps:121/726 (17%)


Mouse    33 QEDDFRVTCKELHRI--PSLPPSTQTLKLIETHLKTIPSLAFSSLPNISRIYLSIDATLQRLEPH 95
            |..:..:|...|..|  ..||.|.|.|.:....|.||...||..:..:.::.||...||:     
  Fly   371 QLQELSITSNRLRWINDTELPRSMQMLDMRANPLSTISPGAFRGMSKLRKLILSDVRTLR----- 430

Mouse    96 SFYNLSKMTHIEI--RNTRSLTYIDPDALTELPLLKFLGIFNTGLRIFPDLTKIYSTDIFFILEI 158
            ||..|.....:||  .:...:..:..:...:.|.||.|.:....|:..|:|:.            
  Fly   431 SFPELEACHALEILKLDRAGIQEVPANLCRQTPRLKSLELKTNSLKRIPNLSS------------ 483

Mouse   159 TDNPYMTSVPENAFQGLCNETLTLKLYNNGFTSVQGHAFNGTK-LDAVYLNKNKYLTAIDNDAFG 222
                             |.:...|.|.:|....:||..|||.| |:.:.|:.|: :.|:..|||.
  Fly   484 -----------------CRDLRLLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNR-IKALPQDAFQ 530

Mouse   223 GV--------------------YSGPTLLD---VSSTSVTALPSKGLEHLKELIAKDTWTLKKLP 264
            |:                    :||.|.|:   :.:.....||..||..|..|...:...|::.|
  Fly   531 GIPKLQLLDLEGNEISYIHKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREFP 595

Mouse   265 LSLSFLHLTRADLSYPSHCCAF------KNQKKIRGILESL-----------MCNES------SI 306
            ...:|..:....|||..|||||      .:|||...:.|::           :.|.|      .:
  Fly   596 PPDTFPRIQTLILSYAYHCCAFLPLVAMSSQKKTSQVQEAVLFPSDAEFDMTLWNNSMMNIWPQM 660

Mouse   307 RNLRQRKSVNILRGPIYQEYEEDPGDNSVGYKQNSKFQESP---SNSHYYVFFEEQE----DEVV 364
            .||.::...::          .||.:.::.:.:.....::.   :.|:...:|||.:    ....
  Fly   661 HNLSKQLGASM----------HDPWETAINFNEEQLQTQTGGQIATSYMEEYFEEHDVSGPATGY 715

Mouse   365 GFGQEL-KNPQEETLQAFESHYDYTVCGDNEDMVCTPKSDEFNPCEDIMGYRFLRIVVWFVSLLA 428
            |||..| .....|..|.             ..:.|.|....|.||.|:..:..||..||.|.||:
  Fly   716 GFGTGLFSGMSTEDFQP-------------GSVQCLPMPGPFLPCADLFDWWTLRCGVWVVFLLS 767

Mouse   429 LLGNIFVLLILLTSHYKLTVPRFLMCNLAFADFCMGVYLLLIASVDLYTHSEYYNHAIDWQTGPG 493
            ||||..|:.:||.|..|:.|||||:||||.|||.||:||.::|.||..|..|:...||.||....
  Fly   768 LLGNGTVVFVLLCSRSKMDVPRFLVCNLAAADFFMGIYLGILAIVDAATLGEFRMFAIPWQMSVL 832

Mouse   494 CNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHAYTIMAGGWVSCFLLALLPMV 558
            |..:||..|.:||||||||.||||||.||||.|:.|::::.|:.|..||:.|||...::||:|:|
  Fly   833 CQLSGFLAVLSSELSVYTLAVITLERNYAITHAIHLNKRLSLKQAGYIMSVGWVFALIMALMPLV 897

Mouse   559 GISSYAKVSICLPMDTDT-PLALAYIVLVLLLNVVAFVVVCSCYVKIYITVRNPQ-YNPRDKDTK 621
            |:|.|.|.::|||.:|.| |.:|.|::.::.:|..||:.:..||:|:|..:|..| :|  ..|::
  Fly   898 GVSDYRKFAVCLPFETTTGPASLTYVISLMFINGCAFLTLMGCYLKMYWAIRGSQAWN--TNDSR 960

Mouse   622 IAKRMAVLIFTDFMCMAPISFYALSALMNKPLITVTNSKILLVLFYPLNSCANPFLYAIFTKAFQ 686
            ||||||:|:||||:|.:||:|::::|:....||::..:||..|...|||||.|||||||.||.|:
  Fly   961 IAKRMALLVFTDFLCWSPIAFFSITAIFGLQLISLEQAKIFTVFVLPLNSCCNPFLYAIMTKQFK 1025

Mouse   687 RDVFILLSKF 696
            :|...|...|
  Fly  1026 KDCVTLCKHF 1035

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TshrNP_035778.3 leucine-rich repeat 54..77 CDD:275380 7/23 (30%)
LRR_5 65..221 CDD:290045 36/159 (23%)
leucine-rich repeat 78..102 CDD:275380 7/24 (29%)
LRR 1 100..124 3/26 (12%)
leucine-rich repeat 103..127 CDD:275380 3/26 (12%)
LRR 2 125..150 7/25 (28%)
leucine-rich repeat 128..152 CDD:275380 6/24 (25%)
LRR 3 151..174 0/23 (0%)
leucine-rich repeat 153..177 CDD:275380 1/24 (4%)
LRR 4 176..199 8/23 (35%)
leucine-rich repeat 181..201 CDD:275380 8/20 (40%)
LRR 5 200..223 8/24 (33%)
leucine-rich repeat 202..226 CDD:275380 8/44 (18%)
LRR 6 225..248 8/26 (31%)
LRR 7 264..288 10/30 (33%)
7tm_4 423..>556 CDD:304433 70/133 (53%)
7tm_1 431..678 CDD:278431 120/249 (48%)
PDZ-binding 762..764
rkNP_476702.1 leucine-rich repeat 158..179 CDD:275380
LRR_RI 180..>383 CDD:238064 3/12 (25%)
leucine-rich repeat 183..204 CDD:275380
LRR_8 203..263 CDD:290566
leucine-rich repeat 205..228 CDD:275380
leucine-rich repeat 229..252 CDD:275380
LRR_8 252..311 CDD:290566
leucine-rich repeat 253..276 CDD:275380
leucine-rich repeat 277..300 CDD:275380
LRR_8 299..359 CDD:290566
leucine-rich repeat 301..324 CDD:275380
leucine-rich repeat 325..348 CDD:275380
LRR_RI 327..567 CDD:238064 52/231 (23%)
leucine-rich repeat 349..371 CDD:275380 233/726 (32%)
LRR_8 370..425 CDD:290566 16/54 (30%)
leucine-rich repeat 372..393 CDD:275380 5/21 (24%)
leucine-rich repeat 394..415 CDD:275380 7/21 (33%)
leucine-rich repeat 418..486 CDD:275380 17/102 (17%)
leucine-rich repeat 441..464 CDD:275378 3/23 (13%)
LRR_8 487..545 CDD:290566 17/59 (29%)
leucine-rich repeat 487..510 CDD:275380 9/23 (39%)
leucine-rich repeat 511..534 CDD:275380 8/24 (33%)
LRR_8 533..589 CDD:290566 10/56 (18%)
leucine-rich repeat 535..558 CDD:275380 3/23 (13%)
leucine-rich repeat 559..580 CDD:275380 5/21 (24%)
7tm_4 764..>892 CDD:304433 67/128 (52%)
7tm_1 770..1017 CDD:278431 120/249 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2087
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001020
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.