DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tpo and cd

Sequence 1:XP_011242158.1 Gene:Tpo MGIID:98813 Length:915 Species:Mus musculus
Sequence 2:NP_651081.1 Gene:cd FlyBaseID:FBgn0263986 Length:830 Species:Drosophila melanogaster

Alignment Length:622 Identity:212/623 (34%)
Similarity:318/623 (51%) Gaps:80/623 (13%)


Mouse   144 KYRPITGACNNRDHPR-WGASNTALARWLPPVYEDGFSQPKGWNPNFLYHGFPLPPVREVTRHLI 207
            :||..||.|||:.||| :|||.....|.:.|.|.||.:.|:     ..:|| .|||.|:|:   :
  Fly   217 RYRRSTGVCNNKQHPRTYGASMVPYRRMVSPDYADGIAAPR-----VSHHG-RLPPARQVS---L 272

Mouse   208 QVSNEAVTEDDQYSDFLPVWGQYIDHDIALTPQSTSTAAFWGGVDC--QLTCENQNPCFPIQL-- 268
            ::...:...|..::..|.|:||::||||..|..:||...  ..:||  ..|.|....|:|:.:  
  Fly   273 KIHRSSYETDSNFTVMLAVFGQFMDHDITATSLTTSQEG--ESIDCCVAATREQHPECYPVDILP 335

Mouse   269 --PSNSSGTTACLPFYRSSAACGTGDQGALFGNLSAANPRQQMNGLTSFLDASTVYGSSPGVEKQ 331
              |.......:|:.|.||:.| .||..|          ||.|:|..|:|:|||.|||:....:.|
  Fly   336 DDPYYKQYNISCMNFVRSAPA-PTGRFG----------PRMQLNQATAFIDASVVYGNLEQRQNQ 389

Mouse   332 LRNWSSSAGLLRVNTLHLDAGRAYLPFATAACAPEPGTPRTNRTP----CFLAGDGRASEVPALA 392
            ||::.:  |.||:  ...|.||..||.::   .|..|..|...|.    ||.:||.||:|...|.
  Fly   390 LRSFIN--GSLRM--FVTDDGRQLLPISS---NPADGCNRVQMTRLGKYCFESGDDRANENLLLT 447

Mouse   393 AVHTLWLREHNRLASAFKAINKHWSANTAYQEARKVVGALHQIITMRDYIPKILGPD-------- 449
            ::|.||.|.||.||...:..|.||.....||||||::||....||..:::|.:||.:        
  Fly   448 SMHLLWARHHNYLARQLQEQNPHWEDERLYQEARKILGAQMAHITYNEFLPVLLGKNISEAKGLL 512

Mouse   450 AFRQYVGPYEGYNPTVNPTVSNIFSTAAFRFGHATVHPLVRRLNTDFQEHTELPRLQLRDVFFRP 514
            ..:..:...:.|:|.|:|:::|.|:.|||||.| |:.|.:..::.|   ::....::|..:.|.|
  Fly   513 PAKHNLNAPDTYDPEVDPSIANCFAAAAFRFAH-TLLPGLFNISRD---NSTPEAIELHKMLFNP 573

Mouse   515 WRLIQEGGLDPIVRGLLARAAKLQVQGQLMNEELTERLFVLSNVGT---------LDLASLNLQR 570
            :.|..|.|:|..:. ..|....:||. :..:.|:|::||    .||         |||.|||:||
  Fly   574 FSLWAEHGIDHALM-TAANTPVMQVD-RFFSLEVTQKLF----EGTAEDRVPLCGLDLVSLNIQR 632

Mouse   571 GRDHGLPDYNEWREFCGLSRLETPAELNKAIANRSMVNKIMDLYKHADNIDVWLGGLAEKFLPGA 635
            |||||:|.|..:|..|.|..::|..|:::||.|.:: :.|..:|:...::||:.|.|:|..|.||
  Fly   633 GRDHGIPSYPVFRRHCRLPTVDTWEEMSQAIDNATL-DSIRQIYESPQDVDVYTGALSEPPLDGA 696

Mouse   636 RTGPLFACIIGKQMKALRDGDRFWWE---NTNVFTDAQRQELEKHSLPRVICDNT-GLTRV---P 693
            ..|||.:|::..|...|:.||..|:|   ....||.||..|:.|.||..:||.|: |:|||   .
  Fly   697 IFGPLLSCMVSDQFLRLKLGDSHWYERKMGPQKFTKAQLAEIYKTSLAAIICRNSDGITRVREHV 761

Mouse   694 VDAFRIGKFPQDFESCEDIPS--MDLELWRE-TFPQD 727
            :...|.|..|.  ..|:|:..  .:.|.|.| ..|||
  Fly   762 MQRLRDGGNPH--VDCQDLEGFHFNFEPWSEKQQPQD 796

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TpoXP_011242158.1 An_peroxidase 145..687 CDD:281139 197/573 (34%)
thyroid_peroxidase 161..722 CDD:188657 198/597 (33%)
CCP 730..783 CDD:153056
EGF_CA 784..826 CDD:284955
cdNP_651081.1 An_peroxidase 218..755 CDD:281139 198/577 (34%)
peroxinectin_like 364..750 CDD:188655 142/404 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2408
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 310 1.000 Inparanoid score I2565
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D276568at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.