DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ALDH1B1 and CG31075

Sequence 1:NP_000683.3 Gene:ALDH1B1 HGNCID:407 Length:517 Species:Homo sapiens
Sequence 2:NP_001247324.1 Gene:CG31075 FlyBaseID:FBgn0051075 Length:508 Species:Drosophila melanogaster

Alignment Length:511 Identity:287/512 (56%)
Similarity:372/512 (73%) Gaps:8/512 (2%)


Human     2 LRFLAPRLLSLQGRTARYSSAAALPSPILNPDIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIG 66
            |:.|....|::..:.:::....|...|      .|.|||||||:.|:||.|||.|.||.|.:.|.
  Fly     5 LQKLLAHQLAVSRKWSKFDHTYAQCEP------NYCQLFINNEFVDSVSGKTFATFNPATSKEIV 63

Human    67 HVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLDNGKPF 131
            .|:|||:||:|.|||||::||...|.||::...:|..|:|:|..|::||:.:||||||.|||||:
  Fly    64 QVSEGDKADIDLAVKAAKKAFHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPY 128

Human   132 QESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKL 196
            .|: ..|:...|...:|:|||.||:.|.|||..| ....||.|||||.|||||||:||:|..||.
  Fly   129 AEA-LFDVTYSILTLQYYAGWTDKFFGDTIPAGG-FVSMTRKEPVGVVGQIIPWNYPLLMLAWKW 191

Human   197 APALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIITGYGPTAGAAIAQHVDVDKVAFT 261
            .||||.|.|::||.||||||:||::|:|.||||||.||:|::.|:||||||||:.|.|:.|||||
  Fly   192 GPALAVGCTIIMKPAEQTPLTALHMAALAKEAGFPAGVINVVNGFGPTAGAAISAHPDIAKVAFT 256

Human   262 GSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADMEHAVEQCHEALFFNMGQCCCAGSRTF 326
            ||.|:|.::.:||..||||||:||||||||.:|..|||::.|||..|||||.|.||.|||||||:
  Fly   257 GSVEIGRIVMQAAATSNLKRVSLELGGKSPVVVFDDADIDFAVETTHEALFSNHGQSCCAGSRTY 321

Human   327 VEESIYNEFLERTVEKAKQRKVGNPFELDTQQGPQVDKEQFERVLGYIQLGQKEGAKLLCGGERF 391
            |.|.||:||:.:...|||.||||||||.:.|||||:|.:...:|||||:.|:||||||..||:|.
  Fly   322 VHEKIYDEFVAKAAAKAKARKVGNPFEQNVQQGPQIDDDMLTKVLGYIESGKKEGAKLQAGGKRI 386

Human   392 GERGFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGLAAAVFTRDLDKA 456
            |..|||::||||..|:||||||:||||||||.:|||..:||:::||||.:|||||.|.|.|::||
  Fly   387 GNVGFFVEPTVFSDVKDDMRIAQEEIFGPVQSIFKFSSLEEMIDRANNVQYGLAAGVITNDINKA 451

Human   457 MYFTQALQAGTVWVNTYNIVTCHTPFGGFKESGNGRELGEDGLKAYTEVKTVTIKV 512
            :.|...:.||:||:|.|:.|...|||||:|.||.|||||:|||..|.|.||:|:|:
  Fly   452 LKFANNVDAGSVWINCYDAVLPSTPFGGYKHSGIGRELGKDGLDNYLETKTITMKL 507

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ALDH1B1NP_000683.3 ALDH_F1AB_F2_RALDH1 31..511 CDD:143459 281/480 (59%)
CG31075NP_001247324.1 ALDH-SF 33..506 CDD:299846 281/475 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99482970
eggNOG 1 0.900 E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000142
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126638
Panther 1 1.100 O PTHR11699
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.