DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tlr6 and Tl

Sequence 1:XP_006503921.1 Gene:Tlr6 MGIID:1341296 Length:806 Species:Mus musculus
Sequence 2:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster

Alignment Length:966 Identity:203/967 (21%)
Similarity:339/967 (35%) Gaps:312/967 (32%)


Mouse    49 YSNRNLTHVPKDLPPRTKALSLSQNSISELRMPDISF--LSELRVLRLSHNRIRSLDFHVFLFNQ 111
            ::.|.|||:|.:|....:.||..:...:...||...|  |..|..:....|::|.:...:|....
  Fly   157 FTTRRLTHIPANLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMP 221

Mouse   112 DLEYLDVSHNRLQNISCCPM---ASLRHLDLSFNDFDVLPVCKEFGNLTKLTFLGLSAAKFRQLD 173
            .|:.|::..|:|.|::....   .|:..:|:..|..:.|| ...|.:||.:|.:.|||..||.|.
  Fly   222 KLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLP-HDVFAHLTNVTDINLSANLFRSLP 285

Mouse   174 LLPVAHLHLSCILLDLVSYHIKGGETESLQIPNTTVLHLVFHPNSLFSVQVNMSVNAL------- 231
            .....|           :.|:......:.::|..|:      |:.||:.|..:.:..|       
  Fly   286 QGLFDH-----------NKHLNEVRLMNNRVPLATL------PSRLFANQPELQILRLRAELQSL 333

Mouse   232 -GHL-----QLSNIKLNDENCQRLMTFLSE--------------LTRGPTLL-----NVTLQHIE 271
             |.|     |::||.|.|...:.|...|.|              ||..|..|     |:|...:|
  Fly   334 PGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLE 398

Mouse   272 TTWKCSVK--LFQFFWPRPVEYLNIYNLT--ITER-----IDREEFTYSETALKSLMIEHVKNQV 327
            ......:.  :|.          |:.||.  :..|     ||...|. |...|:.|.::|  |.:
  Fly   399 DNLLTGISGDIFS----------NLGNLVTLVMSRNRLRTIDSRAFV-STNGLRHLHLDH--NDI 450

Mouse   328 FLFSKEALYSVFAEMNIKMLSISDTPFIHMVCPPSPSSFTFLNFTQNVFTDSVFQGCSTLK-RLQ 391
            .|  ::.|..:..:..|      ::||.:|                        .|..||. |..
  Fly   451 DL--QQPLLDIMLQTQI------NSPFGYM------------------------HGLLTLNLRNN 483

Mouse   392 TLILQRNGLKNFFKVALMTKNMSSLETLDVSLNSLNSHAYDRTCAWAESILVLNLS--------- 447
            ::|...|..||         .|..|..||:|.|:::|..|:.....:::.|.:|::         
  Fly   484 SIIFVYNDWKN---------TMLQLRELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIAL 539

Mouse   448 ------------------------------------------------------------SNMLT 452
                                                                        .|:|.
  Fly   540 PEDVHLGEGYNNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLE 604

Mouse   453 GSVFRCLPP------------------------------KVKVLDLHNNRIMSIPK--DVTHLQA 485
            |:..|.:.|                              |..|::.|:..:..:|:  ::.....
  Fly   605 GTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPRLPNLHKNMQ 669

Mouse   486 LQELNVASNSLTDLPGCG--AFSSLSVLVIDHNSVSHPSED------------------------ 524
            |.||::.:|:|..||...  .:.|::.|.:..|:::....|                        
  Fly   670 LMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDISWNHLQMLNATVL 734

Mouse   525 -FFQSCQNIRSLTAGNNPFQCTCELR-------DFVKNIG------WVAREVVEGWPDSYRCDYP 575
             |.......||:....||:.|.|..:       |..:.||      .|..|:.....:....|..
  Fly   735 GFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMMCVNAEMPTRMVELSTNDIC 799

Mouse   576 ESSKGTALRDFHMSPLSCDTVLLTVTIGATMLVLAVTGAFLCLYFDLP-----W-YVRMLCQWTQ 634
            .:.||.             .:.|.|.|..|.|:...|.|   ||:...     | |...|..|..
  Fly   800 PAEKGV-------------FIALAVVIALTGLLAGFTAA---LYYKFQTEIKIWLYAHNLLLWFV 848

Mouse   635 TRHRARHIPLEELQRNLQFHAFVSYSEHDSAWVKNELLPNLE--KDDIRVCLHERNFVPGKSIVE 697
            |.        |:|.::.:|.||:|||..|.:::::.|:|.||  ....::|:|||:::.|..|.|
  Fly   849 TE--------EDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPE 905

Mouse   698 NIINFIEKSYKAIFVLSPHFIQSEWCHYELYFAHHNLFHEGSDNLILILLEPILQNNIPSRYHKL 762
            ||:..:..|.:.|.|||.:||:|||...|...||.:..:||...:|:|:...|  .::.....:|
  Fly   906 NIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDI--GDVEKLDEEL 968

Mouse   763 RALMAQRTYLEWPTEKGKRGLFWANLRASF-------------IMKLALVNEDDVK 805
            :|.:...|||:|...     .||..||.:.             ::|.||....|.|
  Fly   969 KAYLKMNTYLKWGDP-----WFWDKLRFALPHRRPVGNIGNGALIKTALKGSTDDK 1019

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tlr6XP_006503921.1 leucine-rich repeat 47..64 CDD:275380 6/15 (40%)
PLN00113 50..>540 CDD:331614 122/665 (18%)
leucine-rich repeat 65..88 CDD:275378 6/25 (24%)
leucine-rich repeat 89..112 CDD:275378 4/23 (17%)
leucine-rich repeat 113..133 CDD:275378 5/23 (22%)
leucine-rich repeat 134..158 CDD:275378 7/24 (29%)
leucine-rich repeat 184..206 CDD:275380 2/22 (9%)
leucine-rich repeat 207..230 CDD:275380 5/23 (22%)
leucine-rich repeat 290..314 CDD:275380 8/31 (26%)
leucine-rich repeat 315..343 CDD:275380 6/28 (21%)
leucine-rich repeat 344..365 CDD:275380 4/21 (19%)
leucine-rich repeat 390..415 CDD:275380 5/25 (20%)
leucine-rich repeat 416..440 CDD:275380 7/24 (29%)
leucine-rich repeat 441..462 CDD:275380 7/120 (6%)
leucine-rich repeat 463..485 CDD:275380 3/24 (13%)
leucine-rich repeat 486..508 CDD:275380 8/24 (33%)
leucine-rich repeat 510..531 CDD:275380 4/46 (9%)
LRRCT 540..594 CDD:214507 12/67 (18%)
TIR 652..791 CDD:214587 48/141 (34%)
TlNP_001262995.1 LRR_8 174..233 CDD:290566 13/59 (22%)
leucine-rich repeat 176..198 CDD:275380 6/22 (27%)
leucine-rich repeat 199..222 CDD:275380 4/23 (17%)
LRR_RI 216..542 CDD:238064 84/398 (21%)
LRR_8 221..281 CDD:290566 17/61 (28%)
leucine-rich repeat 223..270 CDD:275380 13/48 (27%)
leucine-rich repeat 271..294 CDD:275380 8/34 (24%)
leucine-rich repeat 295..320 CDD:275380 6/31 (19%)
leucine-rich repeat 321..343 CDD:275380 3/22 (14%)
LRR_8 342..402 CDD:290566 15/60 (25%)
leucine-rich repeat 344..367 CDD:275380 7/23 (30%)
leucine-rich repeat 368..391 CDD:275380 4/23 (17%)
LRR_8 390..450 CDD:290566 16/73 (22%)
leucine-rich repeat 392..415 CDD:275380 4/33 (12%)
leucine-rich repeat 416..439 CDD:275380 6/24 (25%)
leucine-rich repeat 440..474 CDD:275380 10/68 (15%)
leucine-rich repeat 475..498 CDD:275380 8/32 (25%)
LRR_8 477..534 CDD:290566 17/66 (26%)
leucine-rich repeat 499..520 CDD:275380 7/21 (33%)
leucine-rich repeat 523..552 CDD:275380 2/29 (7%)
LRRCT 561..619 CDD:214507 5/58 (9%)
LRRNT 631..667 CDD:214470 4/36 (11%)
leucine-rich repeat 664..693 CDD:275380 7/29 (24%)
LRR_8 669..726 CDD:290566 11/57 (19%)
leucine-rich repeat 694..715 CDD:275380 3/21 (14%)
leucine-rich repeat 716..737 CDD:275380 1/21 (5%)
LRRCT 751..800 CDD:214507 10/49 (20%)
TIR 858..996 CDD:214587 48/145 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.