DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tlr4 and Tl

Sequence 1:NP_067272.1 Gene:Tlr4 MGIID:96824 Length:835 Species:Mus musculus
Sequence 2:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster

Alignment Length:812 Identity:190/813 (23%)
Similarity:326/813 (40%) Gaps:232/813 (29%)


Mouse    41 DQKLSKVPDDIPSSTKNID---LSFNPLKILKSYSFSNFSELQWLDLSRCEIETIEDKAWHGLHH 102
            :.:|:.:||.:.:.|.|:.   |..|.|..:....|||...|..|.:||..:.||:.:|:...:.
  Fly   375 NNRLTHLPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNG 439

Mouse   103 LSNLILTGNPIQSFSPGSFSGLTSLENLVAVETKLASLESFPIGQLITLKKLNVAHN---FIHSC 164
            |.:|.|..|.|....|       .|:  :.::|::.|    |.|.:..|..||:.:|   |::: 
  Fly   440 LRHLHLDHNDIDLQQP-------LLD--IMLQTQINS----PFGYMHGLLTLNLRNNSIIFVYN- 490

Mouse   165 KLPAYFSNLTNLVHVDLSYNYIQTITVNDLQFLRENPQVNLSLDMSLN-------PIDFIQDQAF 222
               .:.:.:..|..:|||||.|.::...||.||.:|   .|.::|:.|       |.|....:.:
  Fly   491 ---DWKNTMLQLRELDLSYNNISSLGYEDLAFLSQN---RLHVNMTHNKIRRIALPEDVHLGEGY 549

Mouse   223 QGIKLHELTLRGNFNSSNIMKTC-----LQNLAGLHVHRLILGEFKDERN-LEIFEPSIMEGLCD 281
            ....:|.     :.|.:.::..|     :|.:.|:|..: ...:||...: |...:|:::||...
  Fly   550 NNNLVHV-----DLNDNPLVCDCTILWFIQLVRGVHKPQ-YSRQFKLRTDRLVCSQPNVLEGTPV 608

Mouse   282 VTIDEFRLTYTNDFSDDIVKFHCLANVSAMSLAGVSIKYLEDVPKHFKWQSLSIIRCQLKQFPTL 346
            ..|:...|....|||||..:..|                    |:.        ..|.::.:.  
  Fly   609 RQIEPQTLICPLDFSDDPRERKC--------------------PRG--------CNCHVRTYD-- 643

Mouse   347 DLPFLKSLTLTMNKGSISFKKVALPSLSYLDLSRNALSFSGCCSYSDLGTNSLRHLDLSFNGAII 411
                 |:|.:..:.|:::.    :|.|..|                        |.::       
  Fly   644 -----KALVINCHSGNLTH----VPRLPNL------------------------HKNM------- 668

Mouse   412 MSANFMGLEELQHLDFQHSTLKRVTEFSAFLSLEKLLYLDISYTNTKIDFDGIFLGLTSLNTLKM 476
                     :|..|..:::||.|:..                 .||.        |..|:.:|.:
  Fly   669 ---------QLMELHLENNTLLRLPS-----------------ANTP--------GYESVTSLHL 699

Mouse   477 AGNSFKDNTLSNVFANTTNLTFLDLSKCQLEQISWGVFDTLHRLQLLNMSHNNLLFLDSSHYNQL 541
            |||:.   |..:|....||||.||        |||      :.||:||                 
  Fly   700 AGNNL---TSIDVDQLPTNLTHLD--------ISW------NHLQMLN----------------- 730

Mouse   542 YSLSTLDCSFNRIETSKGILQHFPKSLAFFNLTNNSVACICEHQKFLQWVKEQKQFLVNVEQMTC 606
               :|:....||....:.:           .|:.|...|.|..:..|.:.::..:.:.:..:|.|
  Fly   731 ---ATVLGFLNRTMKWRSV-----------KLSGNPWMCDCTAKPLLLFTQDNFERIGDRNEMMC 781

Mouse   607 ATPVEMNTSLVLDFNNSTCYMYKTI-ISVSVV---SVIVVSTVAFLIYHF--------YFHLILI 659
            .. .||.|.:|....|..|...|.: |:::||   :.::....|.|.|.|        |.|.:|:
  Fly   782 VN-AEMPTRMVELSTNDICPAEKGVFIALAVVIALTGLLAGFTAALYYKFQTEIKIWLYAHNLLL 845

Mouse   660 AGCKKYSRGESI-----YDAFVIYSSQNEDWVRNELVKNLEEGVPRFHLCLHYRDFIPGVAIAAN 719
                .:...|.:     :|||:.||.:::.::.:.||..||.|..:|.||:|.||::.|..|..|
  Fly   846 ----WFVTEEDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQLCVHERDWLVGGHIPEN 906

Mouse   720 IIQEGFHKSRKVIVVVSRHFIQSRWCIFEYEIAQTWQFLSSRSGIIFIV---LEKVEKSLLRQQV 781
            |:: ....||:.|:|:|::||:|.|...|:..|........||.||.|:   :..|||  |.:::
  Fly   907 IMR-SVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIYSDIGDVEK--LDEEL 968

Mouse   782 ELYRLLSRNTYLEWEDNPLGRHIFWRRLKNAL 813
            :.|  |..||||:|.| |.    ||.:|:.||
  Fly   969 KAY--LKMNTYLKWGD-PW----FWDKLRFAL 993

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tlr4NP_067272.1 LRR_8 53..113 CDD:290566 19/63 (30%)
LRR 1 54..75 7/24 (29%)
leucine-rich repeat 58..78 CDD:275380 6/23 (26%)
LRR 2 78..99 7/21 (33%)
leucine-rich repeat 79..102 CDD:275380 7/23 (30%)
LRR 3 102..123 6/21 (29%)
leucine-rich repeat 103..126 CDD:275380 6/23 (26%)
LRR 4 126..147 5/21 (24%)
leucine-rich repeat 127..150 CDD:275380 5/23 (22%)
LRR_8 150..214 CDD:290566 21/74 (28%)
LRR 5 150..171 5/24 (21%)
leucine-rich repeat 151..175 CDD:275380 5/27 (19%)
LRR 6 175..198 11/23 (48%)
leucine-rich repeat 176..204 CDD:275380 12/28 (43%)
LRR 7 204..224 5/27 (19%)
leucine-rich repeat 205..226 CDD:275380 5/28 (18%)
LRR 8 226..247 3/26 (12%)
LRR 9 248..269 5/22 (23%)
LRR 10 329..349 1/20 (5%)
leucine-rich repeat 331..350 CDD:275380 1/19 (5%)
LRR 11 350..370 3/20 (15%)
leucine-rich repeat 351..372 CDD:275380 4/21 (19%)
LRR_RI <369..555 CDD:238064 35/186 (19%)
LRR 12 372..392 2/20 (10%)
leucine-rich repeat 373..398 CDD:275380 2/25 (8%)
LRR 13 398..420 1/22 (5%)
leucine-rich repeat 399..421 CDD:275380 1/22 (5%)
LRR 14 421..442 5/21 (24%)
leucine-rich repeat 422..446 CDD:275380 5/24 (21%)
LRR 15 446..467 2/21 (10%)
leucine-rich repeat 447..470 CDD:275380 3/23 (13%)
LRR 16 470..490 7/20 (35%)
leucine-rich repeat 471..495 CDD:275380 7/24 (29%)
LRR_8 494..554 CDD:290566 16/60 (27%)
LRR 17 495..516 8/21 (38%)
leucine-rich repeat 496..519 CDD:275380 7/23 (30%)
LRR 18 519..540 4/21 (19%)
leucine-rich repeat 520..543 CDD:275380 4/23 (17%)
LRR 19 543..564 3/21 (14%)
TIR 672..813 CDD:214587 53/144 (37%)
TlNP_001262995.1 LRR_8 174..233 CDD:290566
leucine-rich repeat 176..198 CDD:275380
leucine-rich repeat 199..222 CDD:275380
LRR_RI 216..542 CDD:238064 50/187 (27%)
LRR_8 221..281 CDD:290566
leucine-rich repeat 223..270 CDD:275380
leucine-rich repeat 271..294 CDD:275380
leucine-rich repeat 295..320 CDD:275380
leucine-rich repeat 321..343 CDD:275380
LRR_8 342..402 CDD:290566 7/27 (26%)
leucine-rich repeat 344..367 CDD:275380
leucine-rich repeat 368..391 CDD:275380 4/16 (25%)
LRR_8 390..450 CDD:290566 18/60 (30%)
leucine-rich repeat 392..415 CDD:275380 6/23 (26%)
leucine-rich repeat 416..439 CDD:275380 7/23 (30%)
leucine-rich repeat 440..474 CDD:275380 11/47 (23%)
leucine-rich repeat 475..498 CDD:275380 5/27 (19%)
LRR_8 477..534 CDD:290566 19/64 (30%)
leucine-rich repeat 499..520 CDD:275380 10/21 (48%)
leucine-rich repeat 523..552 CDD:275380 6/32 (19%)
LRRCT 561..619 CDD:214507 12/59 (20%)
LRRNT 631..667 CDD:214470 10/99 (10%)
leucine-rich repeat 664..693 CDD:275380 10/94 (11%)
LRR_8 669..726 CDD:290566 24/99 (24%)
leucine-rich repeat 694..715 CDD:275380 7/24 (29%)
leucine-rich repeat 716..737 CDD:275380 12/55 (22%)
LRRCT 751..800 CDD:214507 12/50 (24%)
TIR 858..996 CDD:214587 54/147 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.