DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tlr1 and Tl

Sequence 1:NP_001263374.1 Gene:Tlr1 MGIID:1341295 Length:795 Species:Mus musculus
Sequence 2:NP_001262995.1 Gene:Tl FlyBaseID:FBgn0262473 Length:1117 Species:Drosophila melanogaster

Alignment Length:825 Identity:195/826 (24%)
Similarity:307/826 (37%) Gaps:203/826 (25%)


Mouse    18 TLMKIQLSEECELIIKRPNANLTRVPKDL---PLQTTTLDLSQNNISELQTSDILSLSKLRVLIM 79
            ||.....:.:.||.|.|..|.|..:|.||   ..|.|.:.|..|.:..|..:.:.....|..|.:
  Fly   309 TLPSRLFANQPELQILRLRAELQSLPGDLFEHSTQITNISLGDNLLKTLPATLLEHQVNLLSLDL 373

Mouse    80 SYNRLQYLNISVFKFNTELEYLDLSHNELKVILCHPTVSLKHLDLSFNAFDALPICKEFGNMSQL 144
            |.|||.:|..|:|...|.|..|.|..|.|..|                :.|.      |.|:..|
  Fly   374 SNNRLTHLPDSLFAHTTNLTDLRLEDNLLTGI----------------SGDI------FSNLGNL 416

Mouse   145 QFLGLSGSRVQSSSVQLIAHLNISKVLLVLGDAYGEKEDPESLRHVSTETLHIVFPSKREFRFLL 209
            ..|.:|.:|:::...:.....|                   .|||     ||:........:.||
  Fly   417 VTLVMSRNRLRTIDSRAFVSTN-------------------GLRH-----LHLDHNDIDLQQPLL 457

Mouse   210 DVSVSTTIGLELSNIKCVLEDQGCSYFLRALSKLGKNLKLSNLTLNNVETTWNSFINILQIVWHT 274
            |:.:.|.|.....             ::..|..|       ||..|::...:|.:.|.:..:...
  Fly   458 DIMLQTQINSPFG-------------YMHGLLTL-------NLRNNSIIFVYNDWKNTMLQLREL 502

Mouse   275 PVKYFSISNVKLQGQLAFRMFNYSDTSLKALSIHQVVTDVFSFPQSYIYSIFANMNIQNFTMSGT 339
            .:.|.:||::           .|.|.:                        |.:.|..:..|:..
  Fly   503 DLSYNNISSL-----------GYEDLA------------------------FLSQNRLHVNMTHN 532

Mouse   340 HMVHMLCPSQV-------SPFLHVDFTDNLLTDMVFKDCR-----NLVR------------LKTL 380
            .:..:..|..|       :..:|||..||.|.    .||.     .|||            |:|.
  Fly   533 KIRRIALPEDVHLGEGYNNNLVHVDLNDNPLV----CDCTILWFIQLVRGVHKPQYSRQFKLRTD 593

Mouse   381 SLQKNQLKNLENIILTSAK-MTSLQKLDISQNSL-RYSDGGIPC--AWTQSLLVLNLSSNMLTGS 441
            .|..:|...||...:...: .|.:..||.|.:.. |....|..|  ......||:|..|..|| .
  Fly   594 RLVCSQPNVLEGTPVRQIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLT-H 657

Mouse   442 VFRC--LPPKVKVLDLH--NNRIMSIPK-DVTHLQALQELNVASNSLTDLPGCGAFSSLSVLVID 501
            |.|.  |...:::::||  ||.::.:|. :....:::..|::|.|:||.:......::|:.|.|.
  Fly   658 VPRLPNLHKNMQLMELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDIS 722

Mouse   502 HNSVSHPSE---DFFQSCQNIRSLTAGNNPFQCTCELR-------DFVKNIGWVAREVVEGWPDS 556
            .|.:...:.   .|.......||:....||:.|.|..:       |..:.||             
  Fly   723 WNHLQMLNATVLGFLNRTMKWRSVKLSGNPWMCDCTAKPLLLFTQDNFERIG------------- 774

Mouse   557 YRCDYPESSRGTALRDFHMSPLSCDT---------VLLTVTIGATMLVLAVTGAFLCLYFDLP-- 610
               |..|.....|.....|..||.:.         :.|.|.|..|.|:...|.|   ||:...  
  Fly   775 ---DRNEMMCVNAEMPTRMVELSTNDICPAEKGVFIALAVVIALTGLLAGFTAA---LYYKFQTE 833

Mouse   611 ---W-YVRMLCQWTQTRHRARHIPLEELQRNLQFHAFVSYSGHDSAWVKNELLPNLE--KDDIQI 669
               | |...|..|..|.        |:|.::.:|.||:|||..|.:::::.|:|.||  ....|:
  Fly   834 IKIWLYAHNLLLWFVTE--------EDLDKDKKFDAFISYSHKDQSFIEDYLVPQLEHGPQKFQL 890

Mouse   670 CLHERNFVPGKSIVENIINFIEKSYKSIFVLSPHFIQSEWCHYELYFAHHNLFHEGSDNLILILL 734
            |:|||:::.|..|.|||:..:..|.::|.|||.:||:|||...|...||.:..:||...:|:|:.
  Fly   891 CVHERDWLVGGHIPENIMRSVADSRRTIIVLSQNFIKSEWARLEFRAAHRSALNEGRSRIIVIIY 955

Mouse   735 APIPQYSIPTNYHKLKTLMSRRTYLEWPTEKNKHGLFWANLRASI 779
            :.|.  .:.....:||..:...|||:|...     .||..||.::
  Fly   956 SDIG--DVEKLDEELKAYLKMNTYLKWGDP-----WFWDKLRFAL 993

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tlr1NP_001263374.1 LRR_RI <33..163 CDD:238064 34/133 (26%)
leucine-rich repeat 50..73 CDD:275378 4/23 (17%)
LRR_8 51..108 CDD:290566 18/57 (32%)
LRR 1 54..77 4/23 (17%)
leucine-rich repeat 74..97 CDD:275378 10/23 (43%)
LRR 2 78..101 9/23 (39%)
leucine-rich repeat 98..118 CDD:275378 6/20 (30%)
LRR 3 102..125 4/23 (17%)
leucine-rich repeat 119..143 CDD:275378 3/24 (13%)
LRR 4 126..150 5/24 (21%)
leucine-rich repeat 144..156 CDD:275378 4/12 (33%)
LRR 5 151..175 2/24 (8%)
LRR 6 176..199 5/23 (22%)
LRR 7 200..223 5/23 (22%)
LRR 8 224..250 2/26 (8%)
LRR 9 251..278 5/27 (19%)
LRR 10 279..308 4/29 (14%)
LRR 11 309..337 3/28 (11%)
Interaction with bacterial lipopeptide. {ECO:0000250} 316..319 0/3 (0%)
LRR 12 338..361 6/30 (20%)
LRR_RI <355..>487 CDD:238064 43/158 (27%)
leucine-rich repeat 355..376 CDD:275380 10/26 (38%)
LRR 13 362..388 10/43 (23%)
leucine-rich repeat 377..402 CDD:275380 7/26 (27%)
LRR 14 389..414 6/27 (22%)
leucine-rich repeat 403..427 CDD:275380 6/27 (22%)
LRR 15 415..437 6/24 (25%)
leucine-rich repeat 428..449 CDD:275380 9/23 (39%)
LRR 16 438..457 7/23 (30%)
LRR_8 448..503 CDD:290566 13/58 (22%)
leucine-rich repeat 450..472 CDD:275380 5/25 (20%)
LRR 17 458..478 3/21 (14%)
leucine-rich repeat 473..494 CDD:275380 5/21 (24%)
LRR 18 479..500 6/21 (29%)
leucine-rich repeat 495..518 CDD:275380 5/26 (19%)
LRR 19 501..524 4/26 (15%)
LRRCT 527..581 CDD:214507 13/61 (21%)
TIR 639..782 CDD:214587 49/144 (34%)
TlNP_001262995.1 LRR_8 174..233 CDD:290566
leucine-rich repeat 176..198 CDD:275380
leucine-rich repeat 199..222 CDD:275380
LRR_RI 216..542 CDD:238064 66/334 (20%)
LRR_8 221..281 CDD:290566
leucine-rich repeat 223..270 CDD:275380
leucine-rich repeat 271..294 CDD:275380
leucine-rich repeat 295..320 CDD:275380 2/11 (18%)
leucine-rich repeat 321..343 CDD:275380 8/22 (36%)
LRR_8 342..402 CDD:290566 19/60 (32%)
leucine-rich repeat 344..367 CDD:275380 4/23 (17%)
leucine-rich repeat 368..391 CDD:275380 10/23 (43%)
LRR_8 390..450 CDD:290566 20/106 (19%)
leucine-rich repeat 392..415 CDD:275380 9/45 (20%)
leucine-rich repeat 416..439 CDD:275380 5/42 (12%)
leucine-rich repeat 440..474 CDD:275380 10/52 (19%)
leucine-rich repeat 475..498 CDD:275380 7/30 (23%)
LRR_8 477..534 CDD:290566 14/99 (14%)
leucine-rich repeat 499..520 CDD:275380 6/56 (11%)
leucine-rich repeat 523..552 CDD:275380 4/29 (14%)
LRRCT 561..619 CDD:214507 14/62 (23%)
LRRNT 631..667 CDD:214470 11/37 (30%)
leucine-rich repeat 664..693 CDD:275380 6/29 (21%)
LRR_8 669..726 CDD:290566 14/57 (25%)
leucine-rich repeat 694..715 CDD:275380 5/21 (24%)
leucine-rich repeat 716..737 CDD:275380 5/21 (24%)
LRRCT 751..800 CDD:214507 13/65 (20%)
TIR 858..996 CDD:214587 49/144 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG4641
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D147327at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24365
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.