DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and Acsl

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_001260810.1 Gene:Acsl FlyBaseID:FBgn0263120 Length:728 Species:Drosophila melanogaster

Alignment Length:716 Identity:348/717 (49%)
Similarity:459/717 (64%) Gaps:38/717 (5%)


Human    32 LYTILTYIPFYFFSE---SRQEKSNRIKAKPVNSK---------PDS-------------AYRSV 71
            :|.|:| :|.|...:   .|::.|.|:||||:|.|         ||.             .||:.
  Fly    19 VYDIIT-LPVYLVLQKPWKRRQDSRRVKAKPINQKMLVDESKYAPDDIEAKIVRNDDNELTYRTT 82

Human    72 N-SLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIFKKVILGQYNWL 135
            : ..|....:|....|||:|||.|....:.:||.||||::|:||||||.||::|||..||.|.|.
  Fly    83 DPPRDVHVKMLQENIDTLEKVFNYVAKTYTSKRCLGTRQILSEEDEVQQNGRVFKKYNLGDYKWK 147

Human   136 SYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQACFMYNFQLVTLYATLGGPAIVH 200
            ::.:....|.|||.||:.|||||:.||.||.||||||||||..||.....:||:|||||...:.|
  Fly   148 TFTEAERTAANFGRGLRELGQKPRENIVIFAETRAEWMIAAHGCFKQAMPIVTVYATLGDDGVAH 212

Human   201 ALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITVDG---KPPTWSEFPKGIIVHTMAAVEAL 262
            .:.|||||.:|||.:|| .|.|.::...|.::.||.::.   |..| :.|.:|:.:.....|...
  Fly   213 CITETEVTTVITSHDLL-PKFKTLLDKCPLVKTIIYIEDQLQKTET-TGFKEGVKILPFNQVVKT 275

Human   263 GAKASMENQPHSKPLPSDIAVIMYTSGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGY 327
            |..:..|:.|   |...|||:|||||||||.||||::||.|.||.:.|..:.:| :..:||.||:
  Fly   276 GQDSKFEHVP---PKGDDIAIIMYTSGSTGTPKGVLLSHKNCIATMKGFVDMVP-IYPDDVLIGF 336

Human   328 LPLAHVLELSAELVCLSHGCRIGYSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYK 392
            ||||||.||.||.|||..|..||||:|.||.|.|||||:|.|||.::||||.|.:||.|:|||.|
  Fly   337 LPLAHVFELVAESVCLMTGVPIGYSTPLTLIDTSSKIKRGCKGDATVLKPTCMTSVPLILDRISK 401

Human   393 NVMNKVSEMSSFQRNLFILAYNYKMEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSA 457
            .:.:||:..|:|:::||...|.||::.:.:|..|||.|..||:||..|:||.:|:::.|||||||
  Fly   402 GINDKVNSGSAFKKSLFKFLYQYKVKWVQRGYKTPLIDKLVFKKVAKLMGGKVRIIMSGGAPLSA 466

Human   458 TTQRFMNICFCCPVGQGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKP 522
            .|...:..|.|..:.|||||||:....|:.:..|...||.|.||..|:|:|.|||||.|..|:||
  Fly   467 DTHEQIKTCLCLELIQGYGLTETTSGATVMDYRDMTYGRTGGPLTVCDIRLVNWEEGNYRVTNKP 531

Human   523 HPRGEILIGGQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQ 587
            :|:||:||||:.|:.||||...||..|||| |:||||..||||||.:.||.||||||||||||||
  Fly   532 YPQGEVLIGGECVSQGYYKLPGKTNEDFFE-EDGQRWFKTGDIGEIQADGVLKIIDRKKDLVKLQ 595

Human   588 AGEYVSLGKVEAALKNLPLVDNICAYANSYHSYVIGFVVPNQKELTELARKKGL-KGTWEELCNS 651
            |||||||||||:.||...:::|||.|.:....|.:..|||||..|.|||:|.|| ..::||||:|
  Fly   596 AGEYVSLGKVESELKTCGIIENICVYGDPTKQYTVALVVPNQNHLEELAQKHGLGDKSFEELCSS 660

Human   652 CEMENEVLKVLSEAAISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHYQADIERM 716
            ..:|..:||.::|.|....|:|:|:|..|.|..|.|:|:.||||.|||||||:::..||.||.||
  Fly   661 PIIEKAILKEIAEHARKCKLQKYEVPAAITLCKEVWSPDMGLVTAAFKLKRKDIQDRYQHDINRM 725

Human   717 Y 717
            |
  Fly   726 Y 726

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 347/715 (49%)
AcslNP_001260810.1 PLN02387 95..727 CDD:215217 328/640 (51%)
LC-FACS_euk 142..726 CDD:213293 301/591 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG1022
Hieranoid 1 1.000
Homologene 1 1.000 H3278
Inparanoid 1 1.050 649 1.000 Inparanoid score I779
Isobase 1 0.950 0 Normalized mean entropy S1350
OMA 1 1.010
OrthoDB 1 1.010 D141523at33208
OrthoFinder 1 1.000 FOG0000800
OrthoInspector 1 1.000 T608321
orthoMCL 1 0.900 OOG5_126601
Panther 1 1.100 O PTHR43272
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R654
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.