DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and bgm

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_001285923.1 Gene:bgm FlyBaseID:FBgn0027348 Length:666 Species:Drosophila melanogaster

Alignment Length:723 Identity:158/724 (22%)
Similarity:293/724 (40%) Gaps:134/724 (19%)


Human    59 PVNSKPDSAYRSVN---------SLDGLAS---VLYPGCDTLDKVFTYAKNKFKNKRLLGTREVL 111
            |...:...|||:.|         :.||:.:   :..||      :.....|.:.:...|.|:   
  Fly    13 PNRLRQADAYRTTNRQDAVKIRMAKDGIGAEEPISVPG------LLKRTVNNYGDYPALRTK--- 68

Human   112 NEEDEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAA 176
                    |||       ..|:.::|:....:..........||.:...::.:.....|||..:|
  Fly    69 --------NGK-------NGYHTVTYKQYEQKVHQVAKAFIKLGLEEHHSVGVLAFNCAEWFYSA 118

Human   177 QACFMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLVPRLRHIITV---- 237
            .........:..:|.|....|:.|.|..:....::........|:..|...:|:|:..|.:    
  Fly   119 MGAIHARGIIAGIYTTNSADAVQHVLESSHAQIVVVDDAKQMDKIHAIRDKLPKLKAAIQIQEPY 183

Human   238 -------DGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSDIAV-----IMYTSGS 290
                   ||. ..|||            :|::.. :.:|:|..::  ..::|:     ::||||:
  Fly   184 SPYLKKEDGY-YRWSE------------IESMNV-SDVEDQYMTR--LENVAINECCCLVYTSGT 232

Human   291 TGLPKGVMISHSNI---IAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSH--GCRIG 350
            .|:|||||:||.||   :.||....:|: .:|.|.: :.||||:||...:.::...:.  || |.
  Fly   233 VGMPKGVMLSHDNITFDVRGIVKAMDRV-VVGAESI-VSYLPLSHVAAQTVDIYTCAFVAGC-IW 294

Human   351 YSSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNL--FILAY 413
            ::....|  :.:.:|  |..|.   :||....||.:.::..:.::...|...|.::.|  :....
  Fly   295 FADKDAL--KGTLVK--SLQDA---RPTRFMGVPRVYEKFQERMVAVASSSGSLKKMLASWAKGI 352

Human   414 NYKMEQISKGRNT-----PLCDSFVFRKVRSLLG-GNIRLLLCGGAPLSATTQRFMNICFCCPVG 472
            ..|...:|:|:::     .:..|.:..||:..|| ..:..|....||:|..|:::. :.....:.
  Fly   353 TLKHYMVSQGKSSGGFRYKIAKSLIMSKVKQALGFDRVLTLASAAAPMSPETKKYF-LSLDLKIV 416

Human   473 QGYGLTESAGAGTISEVWDYNTGRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIGGQSVTM 537
            ..:|::|:||..||..........:|..|..||.|..|.:..|:         ||:.|.|:.|.|
  Fly   417 DAFGMSETAGCHTICLPDSVGLNTIGKTLPGCESKFINKDANGH---------GELCIRGRHVFM 472

Human   538 GYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAAL- 601
            ||..|:.||:....:|    .||.:||:|..:..|.:.:..|.|:::....||.:....:|..: 
  Fly   473 GYIDNKEKTEESLDDD----CWLHSGDLGFVDDKGYVSLTGRSKEIIITAGGENIPPVHIENTIK 533

Human   602 KNLPLVDN--ICAYANSYHSYVIGFVVPNQKE----LTELARKKGLKGTWEELCNSCEMEN---- 656
            |.|..:.|  :......|.:.:|.......|:    |.||:.:..:   |   ..|..:|:    
  Fly   534 KELDAISNAFLVGEQRKYLTVLITLKTEVDKDSGEPLDELSHESSV---W---VKSLGVEHKTVS 592

Human   657 ---------EVLKVLSEA---AISASLEKFEIPVKIRLSPEPWTPETGLVTDAFKLKRKELKTHY 709
                     :|.|.:.:|   |...|:...:...|..:.|..::..||.:....|:||..:...|
  Fly   593 DILAAGPCPKVWKSIEDAIKRANKQSISNAQKVQKFTILPHDFSIPTGELGPTLKVKRNVVSKMY 657

Human   710 QADIERMY 717
            ..:||::|
  Fly   658 ADEIEKLY 665

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 157/722 (22%)
bgmNP_001285923.1 FAA1 32..666 CDD:223953 153/705 (22%)
ACSBG_like 69..665 CDD:213299 145/649 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92863409
eggNOG 1 0.900 E1_COG1022
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.