DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and CG11407

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_650831.1 Gene:CG11407 FlyBaseID:FBgn0038733 Length:538 Species:Drosophila melanogaster

Alignment Length:575 Identity:123/576 (21%)
Similarity:202/576 (35%) Gaps:163/576 (28%)


Human   115 DEVQPNGKIFKKVILGQYNWLSYEDVFVRAFNFGNGLQMLGQKPKTNIAIFCETRAEWMIAAQAC 179
            :|::.:.::..::...:...|:..::...|.:..:.::.||......:.|...........|.||
  Fly    37 NEMRRHPQLIAQISATENTILTRAELQANAMHIASYMRSLGLLQMDIVGIIARNTTHISAVAYAC 101

Human   180 FMYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELLQTKLKDIVSLV-PRLRHIITVDGKPPT 243
            |            ..|.|. |:||        .|.|  |:.::.:.|:. |   :||..||    
  Fly   102 F------------FNGIAF-HSLN--------ISYE--QSTIEKLFSITRP---NIIFCDG---- 136

Human   244 WSEFPKGIIVHTMAAVEALGAK-ASMENQPH---------SKPLPSDI------------AVIMY 286
             .||.|     ..:|...|..| .:|.|.|.         |.|:..:.            ..|:.
  Fly   137 -DEFEK-----VRSATAQLDVKIITMRNHPSGSIRIDQVLSTPIEKNFQPVRLEQGNDQTLAILC 195

Human   287 TSGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGY 351
            :||:||:||.|.|::|..|...:      ..|...||...:..|..:..|   |..::.|.   :
  Fly   196 SSGTTGIPKAVTITNSRQILNSS------HSLTTNDVQYSHSTLDWITGL---LTTVTSGV---F 248

Human   352 SSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYK 416
            |:.:.:||....                    ||...|:          :...|....|.|..:.
  Fly   249 STKRIIADNIFD--------------------PEFFMRL----------VEEHQITWIIQAPAHM 283

Human   417 MEQISKGRNTPLCDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQ-----RFMNICFCCPVGQGYG 476
            ...:    |:|   ||....:.||     |..|.||:..|..||     |....|    :...||
  Fly   284 AMMV----NSP---SFTTSDLSSL-----RYYLFGGSRASVETQHRIRSRLSKDC----LHFAYG 332

Human   477 LTESAGAGTISEVWDYNTGRVGAPLVCCEIKLK-NWEEGGYFNTDKPHPRGEILIGGQSVTMGYY 540
            .||......::..:|.....||.  :...:||| ..|:|.....|:.   ||:.:.......|||
  Fly   333 FTELGSMAALNLHFDEKPNSVGR--LVAGLKLKVICEKGESLGPDEV---GELCLWNGQYWAGYY 392

Human   541 KNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGKVEAALKNLP 605
            .|..:|    .:..:...|..|||:|..:.||.:.|::||||::|.|...|.. .::|:.:..:|
  Fly   393 GNPEET----HKMRDHHNWFHTGDLGYVDDDGFIYIVERKKDMLKFQNIMYYP-NEIESVISKMP 452

Human   606 LVDNICAYANSYHSYVIGFVVPNQKELTELARKKGLKGTWEELCNSCEMENEVLK 660
            .|..:|.:                             |.|.|: |..|....|:|
  Fly   453 DVVEVCVF-----------------------------GVWNEI-NGDEATAAVVK 477

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 123/576 (21%)
CG11407NP_650831.1 CaiC 26..523 CDD:223395 123/576 (21%)
Firefly_Luc_like 47..522 CDD:213279 122/566 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92595170
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.