DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ACSL3 and CG11391

Sequence 1:NP_001341087.1 Gene:ACSL3 HGNCID:3570 Length:720 Species:Homo sapiens
Sequence 2:NP_650830.1 Gene:CG11391 FlyBaseID:FBgn0038732 Length:542 Species:Drosophila melanogaster

Alignment Length:602 Identity:140/603 (23%)
Similarity:219/603 (36%) Gaps:188/603 (31%)


Human    60 VNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKIF 124
            :|..|.::|..|..       ::.||         :::...|:.|. ..:::..:.:.||. :||
  Fly     4 LNGNPATSYDPVQK-------VWSGC---------SRHSLYNEELT-VGQIIFRQLQRQPQ-RIF 50

Human   125 KKVILGQYNWLSYED--------VFVRAFNFGNGLQMLGQKPKTN-IAIFCETRAEWMIAAQACF 180
            :         :|:.|        :...|...|..|:..|.|.:|: :.:...........|..| 
  Fly    51 Q---------ISHTDNTRLTRFQMLQNAAKIGCYLRDQGFKKETDLVGLMARNSTHVGALAYGC- 105

Human   181 MYNFQLVTLYATLGGPAIVHALNETEVTNIITSKELL------------QTKLKDIVSLVPRLRH 233
            ::|          |.|  .||:|.....|.|:|...:            ..|:|||.:.:..|  
  Fly   106 LFN----------GTP--FHAVNPNLEHNTISSLYKITRPRILCCDTADYEKIKDIGASLGAL-- 156

Human   234 IITVDGKPPTWSEFPKGIIVHTMAAVEALGAKASMENQPHSKPLPSD------------IAVIMY 286
            ||||:||.|       |:|  ::|.:        ::|     |||.|            ...|:.
  Fly   157 IITVNGKLP-------GVI--SVADI--------LQN-----PLPDDYEPAQFQRGVDRTMAILC 199

Human   287 TSGSTGLPKGVMISHSNIIAGITGMAERIPELGEEDVYIGYLPLAHVLELSAELVCLSHGCRIGY 351
            :||:||.||.|.:|:|.      .:.|....||.:||..                          
  Fly   200 SSGTTGTPKAVTLSNSR------KLFEMHSYLGSDDVQY-------------------------- 232

Human   352 SSPQTLADQSSKIKKGSKGDTSMLKPTLMAAVPEIMDRIYKNVMNKVSEMSSFQRNLFILAYNYK 416
             :|.||...:..|             ||:.|.      ::..|....|||.|....|.|...:..
  Fly   233 -APSTLDWLTGLI-------------TLVTAA------VFGTVRLISSEMFSTAHFLDICEQHEV 277

Human   417 MEQISKGRNTPL---CDSFVFRKVRSLLGGNIRLLLCGGAPLSATTQRFMNICFCCPVGQG---- 474
            ...|....:..:   |.....:|:|||.    .||..||..|.||.::..:...    |.|    
  Fly   278 SWTIMANSHVAMLANCPKTSAQKLRSLK----HLLFAGGHCLVATLKKMQSFLH----GSGILRN 334

Human   475 -YGLTESAGAGTISEVWDYNT-------GRVGAPLVCCEIKLKNWEEGGYFNTDKPHPRGEILIG 531
             |||||   .||:.. ::|:|       ||:.|     .|::|..:..|  ....|...||||..
  Fly   335 AYGLTE---VGTLVS-YNYDTQSKPTSVGRLMA-----NIRVKIVDSSG--QLQGPKGLGEILCH 388

Human   532 GQSVTMGYYKNEAKTKADFFEDENGQRWLCTGDIGEFEPDGCLKIIDRKKDLVKLQAGEYVSLGK 596
            ......||..|...|.    |..:...|..|||:|.|:.|..|.|::||||::|.....|.. .:
  Fly   389 NGQPWSGYVGNPLATA----EMRDSAGWYHTGDVGYFDEDHYLHIVERKKDMLKYLGMMYYP-HE 448

Human   597 VEAALKNLPLVDNICAY 613
            ||..:..:|.|..:|.:
  Fly   449 VEEVIAQMPDVAEVCVF 465

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ACSL3NP_001341087.1 AMP-binding 30..717 CDD:332499 140/603 (23%)
CG11391NP_650830.1 CaiC 24..541 CDD:223395 134/567 (24%)
AFD_class_I 51..527 CDD:302604 128/538 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C92595220
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.